DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10264 and CG2650

DIOPT Version :8

Sequence 1:NP_650518.1 Gene:CG10264 / 41948 FlyBaseID:FBgn0038394 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_570016.1 Gene:CG2650 / 31252 FlyBaseID:FBgn0000092 Length:260 Species:Drosophila melanogaster

Alignment Length:227 Identity:65/228 (29%)
Similarity:107/228 (47%) Gaps:17/228 (7%)


  Fly    45 PSWLQTCKRSNPNEDKCFRQLFEGCFPALAAGIPEIGVKSFEPLNIDQVSVSKG--SGNLVLSGG 107
            ||.|:.||.   .::.|.....:..|.|...||||..|.:.||:.:..:.:..|  |.::.....
  Fly    30 PSPLKRCKL---QDESCLLAQAQTFFQAFKNGIPERQVAALEPIALGTMFIESGGHSESIKFKLT 91

  Fly   108 FQDLVIRGPSNA----TVRRASLDLERRL-LNFELELPRLRIRAKYNLKGNILLLPLVGSGDVAM 167
            ..|..:...:|:    :::..:.||.|.| |...|:.|.|.:||||::.|.:|:||:|..||:.:
  Fly    92 MSDAKLYNLANSMMVKSLKGFTKDLTRPLKLTLLLDNPELEVRAKYDVDGKLLILPIVSKGDLTI 156

  Fly   168 ALKNVHTTVYTRISLRNETRT-GDEIIHIDEMKVGFDVGAMRIHLKNLFNGNEILAASINSFLNQ 231
            .|.:|||.|:  |:.....|: |...::|.:.|....:......|.||||.|:.|..|....|||
  Fly   157 RLNDVHTKVW--ITAEPVKRSDGHTYLNITDYKTATKIKGGHFDLSNLFNDNKELRDSTLKVLNQ 219

  Fly   232 NGKEVIAELRPDLELGLADIF----HGLWNNV 259
            ....:..:::|.:....|..|    ..||.|:
  Fly   220 EWSTLALDVQPKINEACAKAFSAIVQSLWANI 251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10264NP_650518.1 JHBP 42..270 CDD:214779 65/228 (29%)
CG2650NP_570016.1 JHBP 29..258 CDD:214779 65/228 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1399817
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.