DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hel89B and ETL1

Sequence 1:NP_001287351.1 Gene:Hel89B FlyBaseID:FBgn0022787 Length:1923 Species:Drosophila melanogaster
Sequence 2:NP_178318.1 Gene:ETL1 AraportID:AT2G02090 Length:763 Species:Arabidopsis thaliana

Alignment Length:629 Identity:188/630 (30%)
Similarity:296/630 (47%) Gaps:151/630 (24%)


  Fly  1313 KSDPLQARKTRDREFLDYLFNPKSIPNYKVPVPISVELRCYQQAGINWLWFLNKYNLHG-ILCDD 1376
            ::|...|.|..|.:|                .||   |:.||..|:|:|..|.|..:.| ||.|:
plant   195 QNDIDDACKAEDSDF----------------QPI---LKPYQLVGVNFLLLLYKKGIEGAILADE 240

  Fly  1377 MGLGKTLQTICILAGDHMHRQTANLANL-----PSLVICPPTLTGHWVYEVEKFLDQGSVLRPLH 1436
            ||||||:|.|..|         ..|:.|     |.||:||.::..:|..|:.|:....:||:   
plant   241 MGLGKTIQAITYL---------TLLSRLNNDPGPHLVVCPASVLENWERELRKWCPSFTVLQ--- 293

  Fly  1437 YYGFPVGREKLRSDIGT--------KCNLVVASY-------DTVRKDIDFFSGIHFNYCVLDEGH 1486
            |:|  ..|.....::.:        ..|:::..|       :..:.|........::..::||.|
plant   294 YHG--AARAAYSRELNSLSKAGKPPPFNVLLVCYSLFERHSEQQKDDRKVLKRWRWSCVLMDEAH 356

  Fly  1487 IIKNGKTKSSKAIKRL-----KANHRLILSGTPIQNNVLELWSLFDFLMPGFLGTEKQFVQRFSR 1546
            .:|:   |:|...|.|     .||.||:|:|||:||::.|||||.:|::|....||...:::   
plant   357 ALKD---KNSYRWKNLMSVARNANQRLMLTGTPLQNDLHELWSLLEFMLPDIFTTENVDLKK--- 415

  Fly  1547 PILSSRDAKSSAKEQEAGVLAMEALHRQVLPFLLRRVKEDVLKDLPPKITQDLLCELSPLQLRLY 1611
             :|::.|.:.        :..|:::   :.||:|||:|.||::.|.|||.:        ::..|.
plant   416 -LLNAEDTEL--------ITRMKSI---LGPFILRRLKSDVMQQLVPKIQR--------VEYVLM 460

  Fly  1612 EDFSNKHLKDCLDKLGDSSSASMVTENLSAKTHIFQAL--RYLQN-------VCNHPKLVLR--Q 1665
            |.......|:.:::...:|.|.:|..:..:...:.:||  |.:.|       :.|||.|:.|  .
plant   461 ERKQEDAYKEAIEEYRAASQARLVKLSSKSLNSLAKALPKRQISNYFTQFRKIANHPLLIRRIYS 525

  Fly  1666 SEELTKVTSQLALSNS-----SLDDI------------------------------EH---SAKL 1692
            .|::.::..:|....:     |||.:                              :|   |||.
plant   526 DEDVIRIARKLHPIGAFGFECSLDRVIEEVKGFNDFRIHQLLFQYGVNDTKGTLSDKHVMLSAKC 590

  Fly  1693 PALKQLLLDCGIGVQTESVSQHRALIFCQLKAMLDIVEQDLLRRHLPSVTYLRLDGSVPASQRQD 1757
            ..|.:||       .:...|.||.|||.|..:||||:|..|   .:..|||.|||||...:.||.
plant   591 RTLAELL-------PSMKKSGHRVLIFSQWTSMLDILEWTL---DVIGVTYRRLDGSTQVTDRQT 645

  Fly  1758 IVNNFNSDPSIDVLLLTTMVGGLGLNLTGADTVIFVEHDWNPMKDLQAMDRAHRIGQKKVVNVYR 1822
            ||:.||:|.||...||:|..||.|||||||||||..:.|:||..|.||.||.|||||.|.|.::|
plant   646 IVDTFNNDKSIFACLLSTRAGGQGLNLTGADTVIIHDMDFNPQIDRQAEDRCHRIGQTKPVTIFR 710

  Fly  1823 LITRNSLEEKIMGLQKFKILTANTVVSA-----ENASL--QTMG 1859
            |:|:::::|.|..:.|.|::....|:.:     :|...  :|||
plant   711 LVTKSTVDENIYEIAKRKLVLDAAVLESGVHVDDNGDTPEKTMG 754

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hel89BNP_001287351.1 HEAT repeat 5..30 CDD:293787
HEAT repeat 42..70 CDD:293787
HEAT repeat 395..420 CDD:293787
HEAT repeat 433..465 CDD:293787
HEAT repeat 475..504 CDD:293787
HEAT repeat 516..540 CDD:293787
HEAT repeat 560..589 CDD:293787
DUF3535 654..1138 CDD:288874
HEAT repeat 1234..1261 CDD:293787
HEAT repeat 1269..1298 CDD:293787
SNF2_N 1353..1662 CDD:278600 94/344 (27%)
DEXDc 1370..1514 CDD:238005 46/170 (27%)
Helicase_C 1689..1813 CDD:278689 63/124 (51%)
ETL1NP_178318.1 SNF2_N 216..520 CDD:278600 94/344 (27%)
DEXDc 233..386 CDD:238005 46/170 (27%)
Helicase_C 587..701 CDD:278689 63/124 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D61251at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.