DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hel89B and smarcad1a

Sequence 1:NP_001287351.1 Gene:Hel89B FlyBaseID:FBgn0022787 Length:1923 Species:Drosophila melanogaster
Sequence 2:NP_001018610.2 Gene:smarcad1a ZFINID:ZDB-GENE-050522-499 Length:972 Species:Danio rerio

Alignment Length:568 Identity:195/569 (34%)
Similarity:300/569 (53%) Gaps:95/569 (17%)


  Fly  1347 SVELRCYQQAGINWLWFLNKYNLHGILCDDMGLGKTLQTICILAGDHMHRQTANLANLPSLVICP 1411
            :::|:.||..|:.||..|:::.|.|||.|:||||||:|.|..||  |::.:.   ...|.|:..|
Zfish   445 NLKLQAYQLIGLKWLILLHQHKLSGILADEMGLGKTIQAIAFLA--HLYEKG---IKGPHLITVP 504

  Fly  1412 PTLTGHWVYEVEKFLDQGSVLRPLHYYGFPVGREKLRSDIGT---KCNLVVASYD-TVRKDID-- 1470
            .:...:||.|:..:...   |:.|.|||....|:.||.||.|   ..|::|::|: |:..|.|  
Zfish   505 SSTLDNWVRELGLWCPS---LKVLIYYGSVEDRKYLRQDILTGLIDFNIIVSTYNLTIGNDHDRS 566

  Fly  1471 FFSGIHFNYCVLDEGHIIKNGKTKSSKAIKRLKANHRLILSGTPIQNNVLELWSLFDFLMPG-FL 1534
            .|..:...|.|.||||::||..:...:.:..:.|.|||:|:|||:|||:|||.||.:|:||. |.
Zfish   567 LFRKLKLKYAVFDEGHMLKNMNSLRYRHLMTINAEHRLLLTGTPLQNNLLELMSLLNFIMPSMFS 631

  Fly  1535 GTEKQFVQRFSRPILSSRDAKSSAKEQEAGV-LAMEALHRQVLPFLLRRVKEDVLKDLPPKITQD 1598
            .:..|..:.||  ..||.:..|..|::.|.. |.|:       ||:|||||.:|||:||||:.:.
Zfish   632 SSTSQISKMFS--TRSSEEESSFHKDRIAQARLIMK-------PFILRRVKSEVLKELPPKMEKI 687

  Fly  1599 LLCELSPLQLRLYEDFSNKHLKDCLDKLGDSSSASMVTENLSAKTHIFQALRYLQNVCNHPKLVL 1663
            .:|.:|..|.:|| |...|.||...:  ||             |..:...:..|:.:.||| |:.
Zfish   688 EMCPMSDAQHKLY-DILFKRLKKTPN--GD-------------KRELCNVMMQLRKMANHP-LLH 735

  Fly  1664 RQ---SEELTKVTSQLALSNSSLDDIEHSAKLPAL-----------------------------K 1696
            ||   |::|.      |:|.:.|.:..|....|||                             |
Zfish   736 RQYYTSDKLA------AMSKAMLKEPTHYDADPALIQEDMEVMSDFELHNLCREYSSISGFQLEK 794

  Fly  1697 QLLLDCG-IGVQTESVSQ-----HRALIFCQLKAMLDIVEQDLLRRHLPSVTYLRLDGSVPASQR 1755
            .|:||.| ..:.|:::::     .|.::|.|...||||||  :|.:||.. .|:|||||.|.::|
Zfish   795 ALILDSGKFALLTKTLAKLKEKGDRVVLFSQFTMMLDIVE--ILLKHLDH-QYVRLDGSTPMAER 856

  Fly  1756 QDIVNNFNSDPSIDVLLLTTMVGGLGLNLTGADTVIFVEHDWNPMKDLQAMDRAHRIGQKKVVNV 1820
            ..:::.:|::|.|.|.||:|..||.|:||..|:|||..:.|.||..|.||.||.||:||.:.|.|
Zfish   857 IGLIDKYNTNPEIFVFLLSTRAGGQGINLASANTVILHDIDCNPFNDKQAEDRCHRMGQTRTVQV 921

  Fly  1821 YRLITRNSLEEKIM--GLQKFKILTANTVVSAENASLQTMGTSQIFDL 1866
            .:||:::|:|:.::  |.:|.|:....|....|:.::    |.|:.:|
Zfish   922 IKLISKDSIEDCMLRVGQEKLKLEQDMTTDEGEDGAI----TEQMAEL 965

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hel89BNP_001287351.1 HEAT repeat 5..30 CDD:293787
HEAT repeat 42..70 CDD:293787
HEAT repeat 395..420 CDD:293787
HEAT repeat 433..465 CDD:293787
HEAT repeat 475..504 CDD:293787
HEAT repeat 516..540 CDD:293787
HEAT repeat 560..589 CDD:293787
DUF3535 654..1138 CDD:288874
HEAT repeat 1234..1261 CDD:293787
HEAT repeat 1269..1298 CDD:293787
SNF2_N 1353..1662 CDD:278600 115/317 (36%)
DEXDc 1370..1514 CDD:238005 54/150 (36%)
Helicase_C 1689..1813 CDD:278689 55/159 (35%)
smarcad1aNP_001018610.2 SNF2_N 451..734 CDD:278600 115/317 (36%)
DEXDc 468..610 CDD:238005 54/150 (36%)
DEGH box 579..582 3/3 (100%)
Helicase_C 800..914 CDD:278689 48/117 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D61251at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.