DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hel89B and smarca5

Sequence 1:NP_001287351.1 Gene:Hel89B FlyBaseID:FBgn0022787 Length:1923 Species:Drosophila melanogaster
Sequence 2:NP_001007993.1 Gene:smarca5 XenbaseID:XB-GENE-494817 Length:1049 Species:Xenopus tropicalis

Alignment Length:674 Identity:208/675 (31%)
Similarity:306/675 (45%) Gaps:100/675 (15%)


  Fly  1279 GAMSDP--------DESVR----LLSTHCFANLVQ-------LMPL-----------DGKTEQLK 1313
            |...||        |.|.|    |..|..||:.:|       ..||           |.|.:.|.
 Frog    69 GNEMDPAYEEKRKTDRSNRFEYLLKQTEVFAHFIQPAAQKTPTSPLKMKPGRPRLKKDEKQDLLS 133

  Fly  1314 SDPLQARKTRDREFLDYLFNPKSIPNYKV---PVPISVE---LRCYQQAGINWLWFLNKYNLHGI 1372
            ....:.|:|...|..:.|.......|...   ..|..|:   ||.||..|:|||..|.:..::||
 Frog   134 MGDYRHRRTEQEEDEELLTESSKTTNVCTRFEDSPSYVKGGTLRDYQVRGLNWLISLYENGINGI 198

  Fly  1373 LCDDMGLGKTLQTICILAGDHMHRQTANLANLPSLVICPPTLTGHWVYEVEKFLDQGSVLRPLHY 1437
            |.|:||||||||||.:|.....:|....    |.:|:.|.:...:|:.|.::::..   |..:..
 Frog   199 LADEMGLGKTLQTISLLGYMKHYRSIPG----PHMVLVPKSTLHNWMAEFKRWVPS---LCAICL 256

  Fly  1438 YGFPVGREKLRSDI--GTKCNLVVASYDTVRKDIDFFSGIHFNYCVLDEGHIIKNGKTKSSKAIK 1500
            .|....|.....|:  ..:.::.|.||:.:.|:...|...::.|.|:||.|.|||.|:|.|:.::
 Frog   257 IGDKDHRAAFVRDVLLPGEWDVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVR 321

  Fly  1501 RLKANHRLILSGTPIQNNVLELWSLFDFLMPGFLGTEKQFVQRFSRPILSSRDAKSSAKEQEAGV 1565
            ..|..:||:|:|||:|||:.|||:|.:||:|....:.:.|...|        |..:...:|:   
 Frog   322 EFKTTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSAEDFDSWF--------DTNNCLGDQK--- 375

  Fly  1566 LAMEALHRQVLPFLLRRVKEDVLKDLPPKITQDLLCELSPLQLRLYEDFSNKHLKDCLDKLGDSS 1630
             .:|.||..:.||||||:|.||.|.||||....:...||.:|...|    .|.|...:|.|..|.
 Frog   376 -LVERLHMVLKPFLLRRIKADVEKSLPPKKEIKIYVGLSKMQREWY----TKILMKDIDILNSSG 435

  Fly  1631 SASMVTENLSAKTHIFQALRYLQNVCNHPKLVLRQSEELTKVTSQLALSNSSLDDIEHSAKLPAL 1695
            ...        |..:...|..|:..||||.| ...:|.....|:.:.|..:|...:.....||.|
 Frog   436 KTD--------KMRLLNILMQLRKCCNHPYL-FDGAEPGPPYTTDMHLVTNSGKMVVLDKLLPRL 491

  Fly  1696 KQLLLDCGIGVQTESVSQHRALIFCQLKAMLDIVEQDLLRRHLPSVTYLRLDGSVPASQRQDIVN 1760
            |:              ...|.|||.|:..:|||:|...:.|   :..|.||||..|..:|||.:.
 Frog   492 KE--------------QGSRVLIFSQMTRVLDILEDYCMWR---NYEYCRLDGQTPHEERQDSII 539

  Fly  1761 NFNSDPSID-VLLLTTMVGGLGLNLTGADTVIFVEHDWNPMKDLQAMDRAHRIGQKKVVNVYRLI 1824
            .:|:..|.. :.:|:|..||||:||..||.||..:.||||..|||||||||||||.|.|.|:|.|
 Frog   540 AYNAPGSSKFIFMLSTRAGGLGINLATADVVIIYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRYI 604

  Fly  1825 TRNSLEEKIMGLQKFKILTANTVVS---AENASLQTMGTSQIFDLFNGG-----KDKGAESGSSA 1881
            |.|::||:|:...:.|:...:.|:.   ..:.:|..:|..::..:...|     ..|.:|.....
 Frog   605 TDNTVEERIVERAEMKLRLDSIVIQQGRLVDQNLNKLGKDEMLQMIRHGATHVFASKDSEITEED 669

  Fly  1882 VQGTASGG----MSMNTIIENLPE 1901
            :......|    ..||..:.|:.|
 Frog   670 INAILERGEKKTAEMNEKLSNMGE 693

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hel89BNP_001287351.1 HEAT repeat 5..30 CDD:293787
HEAT repeat 42..70 CDD:293787
HEAT repeat 395..420 CDD:293787
HEAT repeat 433..465 CDD:293787
HEAT repeat 475..504 CDD:293787
HEAT repeat 516..540 CDD:293787
HEAT repeat 560..589 CDD:293787
DUF3535 654..1138 CDD:288874
HEAT repeat 1234..1261 CDD:293787
HEAT repeat 1269..1298 CDD:293787 10/31 (32%)
SNF2_N 1353..1662 CDD:278600 103/311 (33%)
DEXDc 1370..1514 CDD:238005 47/146 (32%)
Helicase_C 1689..1813 CDD:278689 52/125 (42%)
smarca5NP_001007993.1 PLN03142 7..1004 CDD:215601 208/675 (31%)
DEXDc 196..335 CDD:238005 47/146 (32%)
Helicase_C 478..593 CDD:278689 53/132 (40%)
HAND 739..824 CDD:286232
SANT 840..879 CDD:238096
SLIDE 894..1004 CDD:286233
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D61251at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.