DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hel89B and dom

Sequence 1:NP_001287351.1 Gene:Hel89B FlyBaseID:FBgn0022787 Length:1923 Species:Drosophila melanogaster
Sequence 2:NP_001286676.1 Gene:dom FlyBaseID:FBgn0020306 Length:3233 Species:Drosophila melanogaster

Alignment Length:1947 Identity:377/1948 (19%)
Similarity:582/1948 (30%) Gaps:857/1948 (44%)


  Fly   698 AGGDVSTPGST-------SRKRTPRIGDELGGNILAQSNASLKLYLGGSEATPLDVRDANFMRAR 755
            |..:||...||       .:.:..|:.|.       :...|....:|.:|::.:   .::.:.|.
  Fly   111 AHSNVSVSSSTIEASVLPPQAKRQRLDDN-------EDRTSAASIVGPAESSNI---VSSLLPAS 165

  Fly   756 ISSSRALGALSHYLVQPAPGVVYTPQTESPTDCYTKVLLGHLNAHSAVQRIVCGLIIAFWALEDE 820
            ::||..:|.||...:|.                     |..|......|::             :
  Fly   166 VASSSEVGGLSSTALQD---------------------LNALKKRILQQKL-------------Q 196

  Fly   821 PVRPGPPNLQEKLHQCVSEYVYYDEVAISLTRLLQEA---QDFIATLKQNKIP-INDFNNAKIL- 880
            .:|    ||:|:..:.||||.|           ||..   .|:.|..|:...| ...::||..: 
  Fly   197 ILR----NLKERHLENVSEYFY-----------LQNGGSMMDYPAWRKKTPTPQFISYSNANRID 246

  Fly   881 ----------------------TLDQIEAVATTLSENL-----RSYPLK---------------- 902
                                  |..|.::|.::|...:     :..||.                
  Fly   247 QLIHEDKPSTSAAAAAAQNQKYTTQQTDSVESSLVSGIGTGATKGAPLDGNISNSTVKTNTQSQV 311

  Fly   903 PKVLDMLEERRRSLQASYQQTT-----SEQSAYHVSAQAALA-GAICALHCLPDKLNPVVKPLME 961
            |..:....|...:...|...||     :..:|...||.:|.| |.:.|:..  :...|.|.....
  Fly   312 PSKIGSFTESTPAATESNSSTTVPGTATSGAATSTSATSAEASGNVLAVEA--EIKIPAVGATPV 374

  Fly   962 SIKREQCLQLQQLSAEFLV--------HLMDQVCDRNPSPNSKILNNLCTLLRSDPEFTPKLVMP 1018
            :|..:....:.||:.:..:        |.|  |..:.|:|.:.:.|....|:   |..||  ::|
  Fly   375 AISTKLPAAVVQLTQQGHIPGRPLGGRHGM--VFGQIPAPPAAVGNPSVPLV---PGGTP--LLP 432

  Fly  1019 LETLKQTPVSSEVINNCVYYGILTLALQQTVTTTNTRSGA------GGATTPTATTAPRG----- 1072
            ..|                 ...:.||::.....|..||:      ||:.|||......|     
  Fly   433 CNT-----------------SAGSTALRRPQGQNNASSGSAAASGGGGSLTPTPLYTGNGPAALG 480

  Fly  1073 ------PGRPPTGEILS---------ATNATAHIELKAQQA------------------------ 1098
                  ||.|.:|.:||         ..:|......||:|.                        
  Fly   481 GSGGLTPGTPTSGSLLSPALGGGSGTPNSAAQEFSFKAKQEVYVMQRISELQREGLWTERRLPKL 545

  Fly  1099 ------------------------------KEAEAKQC-------------RIQRLGAA--CAIE 1118
                                          |:..||:|             ..||...|  ..::
  Fly   546 QEPSRPKAHWDYLLEEMVWLAADFAQERKWKKNAAKKCAKMVQKYFQDKATAAQRAEKAQELQLK 610

  Fly  1119 KLCRIFGEQI------IEKVAVFQHLMFGKVEQFVKEAYDWRLGSLLPDL-GVCNELVSSMQLIE 1176
            ::......::      :||:..::|..  |:|:..|:|.|..|..::... ....:||..|....
  Fly   611 RVASFIAREVKSFWSNVEKLVEYKHQT--KIEEKRKQALDQHLSFIVDQTEKFSQQLVEGMNKSV 673

  Fly  1177 TAAPHLHVA--LHPQMFA---LLPSLGFIVCHPLKAVRHMAARCIAVLAEIDACQTMQFV----- 1231
            ...|.|:.:  ..|:..:   ..|..|          .......|| .||.||....:.|     
  Fly   674 ADTPSLNSSRLTSPKRESDDDFRPESG----------SEDDEETIA-KAEEDAADVKEEVTALAK 727

  Fly  1232 ---------VHDLLP-------LLGKIEQL---------------IERQGAIEAIERVVSRLQ-- 1263
                     ::||.|       .|.|.||.               .|.:.|.:..|..:|:.:  
  Fly   728 ESEMDFDDFLNDLPPGYLENRDKLMKEEQSSAIKTETPDDSDDSEFEAKEASDDDENTISKQEEA 792

  Fly  1264 ------IKVVPYIV----LLVVPLLG---------------AMSDP-----DESVRLLSTH---- 1294
                  .|.:..:.    |.|..||.               |..||     |:|..:.||.    
  Fly   793 EQEIDHKKEIDELEADNDLSVEQLLAKYKSEQPPSPKRRKLAPRDPELDSDDDSTAVDSTEESED 857

  Fly  1295 ----------CFANLVQLMPLDGKTEQLKSDPLQARKT--------------------RDREFLD 1329
                      .......:...|.:.:.|||....|..|                    .|...|.
  Fly   858 AATEDEEDLSTVKTDTDMEEQDEQEDGLKSLMADADATSGAAGSGSTAGASGNKDDMLNDAAALA 922

  Fly  1330 YLFNPK----SIPNYKVPVPISVE--LRCYQQAGINWLWFLNKYNLHGILCDDMGLGKTLQTICI 1388
            ....||    |..|...|||..::  ||.||..|::||..:|:..|:|||.|:||||||:|||.:
  Fly   923 ESLQPKGNTLSSTNVVTPVPFLLKHSLREYQHIGLDWLVTMNERKLNGILADEMGLGKTIQTIAL 987

  Fly  1389 LAGDHMHRQTANLANLPSLVICPPTLTGHWVYEVEKFLDQGSVLRPLHYYGFPVGREKLRSDIGT 1453
            ||  |:.....|..  |.|::.|.::..:|..|.:|:.....:|.   |||....| ||:....|
  Fly   988 LA--HLACAKGNWG--PHLIVVPSSVMLNWEMEFKKWCPGFKILT---YYGSQKER-KLKRVGWT 1044

  Fly  1454 KCN---LVVASYDTVRKDIDFFSGIHFNYCVLDEGHIIKNGKTKSSKAIKRLKANHRLILSGTPI 1515
            |.|   :.:.||..|.:|...|....:.|.:|||...|||.|::..:.:.......||:|:|||:
  Fly  1045 KPNAFHVCITSYKLVVQDQQSFRRKKWKYLILDEAQNIKNFKSQRWQLLLNFSTERRLLLTGTPL 1109

  Fly  1516 QNNVLELWSLFDFLMPGFLGTEKQFVQRFSRPILSSRDAKSSAKEQEAGVLAMEALHRQVLPFLL 1580
            ||:::|||||..||||....:.::|.:.||.|:....:......|     ..:..||:.:.||||
  Fly  1110 QNDLMELWSLMHFLMPYVFSSHREFKEWFSNPMTGMIEGNMEYNE-----TLITRLHKVIRPFLL 1169

  Fly  1581 RRVKEDVLKDLPPKITQDLLCELSPLQLRLYEDFSNKHLKDCLDKLGDSSSASMVTENLSAKTHI 1645
            ||:|::|.|.:|.|....:.|.||..|..|||||.::          ..:..::.|.||.:   :
  Fly  1170 RRLKKEVEKQMPKKYEHVITCRLSNRQRYLYEDFMSR----------AKTRETLQTGNLLS---V 1221

  Fly  1646 FQALRYLQNVCNHPK-------------------------------------------LVLRQSE 1667
            ...|..|:.|||||.                                           |:|...:
  Fly  1222 INVLMQLRKVCNHPNMFEARPTISPFQMDGITFHTPRLVCDIMEYDPFTQINLETLNLLLLHLEQ 1286

  Fly  1668 ELTKVTS----------------------------------------QLA--------------- 1677
            .:|...|                                        :||               
  Fly  1287 TMTAYVSHKSRLLAPPRKLIEDIDTAPLPAPRCPNGKYRFHIRVRSAELAQRIKLNAVKVGASPA 1351

  Fly  1678 --------------------------------------------------------------LSN 1680
                                                                          |||
  Fly  1352 MRLEGSKIMPMRNLLPSGRVLKRVSASINPVNMALKPVVINSVVTTTSSSTTASSPTGALSVLSN 1416

  Fly  1681 SSL-------------------------------------------------------------- 1683
            |.|                                                              
  Fly  1417 SKLLGARSQINAPTPAKVAKTMQDGKPFFYLTPATNSGAAGARLTLTSKTTASASTTTSRTTVTA 1481

  Fly  1684 -------------------------------------------DD---------IEHSAKLPALK 1696
                                                       :|         :....:|.|||
  Fly  1482 STTSGQQLIRDPIVKDLATHVKSTVQKQSIANGKTEPEEETEAEDPYKVQELIQMRKEQRLAALK 1546

  Fly  1697 QLLL------------------------------------------------------------- 1700
            ::.:                                                             
  Fly  1547 RMAMINRRRTDATPIYGEDCREAIQRCMQATRSLKRSTWQTRGYANCCTAMAHRNGWSLNHLLKS 1611

  Fly  1701 ----------------------------------------------------------------- 1700
                                                                             
  Fly  1612 FEERCADLKPVFANFVIYVPSVCAPRIRRYVQNLSSTHWQHEQRIENIVDQALRPKLALLHPIIS 1676

  Fly  1701 --------------DCGIGVQTE-------SVSQHRALIFCQLKAMLDIVEQDL-LRRHLPSVTY 1743
                          ||| .:||.       .|:.||.|||.|:..|||::|..| ...|:    |
  Fly  1677 EMTTKFPDPRLIQYDCG-KLQTMDRLLRQLKVNGHRVLIFTQMTKMLDVLEAFLNYHGHI----Y 1736

  Fly  1744 LRLDGSVPASQRQDIVNNFNSDPSIDVLLLTTMVGGLGLNLTGADTVIFVEHDWNPMKDLQAMDR 1808
            ||||||....|||.::..||.|..|...:|:|..||:|:||||||||||.:.||||..|.||.||
  Fly  1737 LRLDGSTRVEQRQILMERFNGDKRIFCFILSTRSGGVGINLTGADTVIFYDSDWNPTMDAQAQDR 1801

  Fly  1809 AHRIGQKKVVNVYRLITRNSLEEKIMGLQKFKILTANTVVSAENASLQTMGTSQIFDLFNGGKDK 1873
            .|||||.:.|::|||::..::|..|:.....|.:.::..:...|.:.....:|.|.|||...:.:
  Fly  1802 CHRIGQTRDVHIYRLVSERTIEVNILKKANQKRMLSDMAIEGGNFTTTYFKSSTIKDLFTMEQSE 1866

  Fly  1874 GAES------GSSAVQGTASGGMSMNTIIENLPELWS----EHQY---EEEYDLGNFVQALK 1922
            ..||      ....:..|.:...:.:|::|.  |..|    ||..   |:|.|    |||.|
  Fly  1867 QDESSQEKSENKDRIVATTTLSDTPSTVVET--EKQSLRAFEHALAAAEDEQD----VQATK 1922

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hel89BNP_001287351.1 HEAT repeat 5..30 CDD:293787
HEAT repeat 42..70 CDD:293787
HEAT repeat 395..420 CDD:293787
HEAT repeat 433..465 CDD:293787
HEAT repeat 475..504 CDD:293787
HEAT repeat 516..540 CDD:293787
HEAT repeat 560..589 CDD:293787
DUF3535 654..1138 CDD:288874 103/610 (17%)
HEAT repeat 1234..1261 CDD:293787 11/49 (22%)
HEAT repeat 1269..1298 CDD:293787 11/67 (16%)
SNF2_N 1353..1662 CDD:278600 108/355 (30%)
DEXDc 1370..1514 CDD:238005 51/147 (35%)
Helicase_C 1689..1813 CDD:278689 63/272 (23%)
domNP_001286676.1 HSA 543..614 CDD:214727 7/71 (10%)
ASF1_hist_chap <674..831 CDD:304562 28/168 (17%)
FAM176 <824..>868 CDD:291517 7/44 (16%)
SNF2_N 952..1238 CDD:278600 107/312 (34%)
DEXDc 969..1108 CDD:238005 51/147 (35%)
Helicase_C 1692..1806 CDD:278689 58/119 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C138580653
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.