DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hel89B and Marcal1

Sequence 1:NP_001287351.1 Gene:Hel89B FlyBaseID:FBgn0022787 Length:1923 Species:Drosophila melanogaster
Sequence 2:NP_608883.1 Gene:Marcal1 FlyBaseID:FBgn0031655 Length:755 Species:Drosophila melanogaster

Alignment Length:639 Identity:158/640 (25%)
Similarity:255/640 (40%) Gaps:146/640 (23%)


  Fly  1276 PLLGAMSDPDESVR------------LLSTHCFA--------NLVQL---MP---LDGKTEQLKS 1314
            |.|...||.::.|.            |:|||.||        .||.:   ||   .||:|.....
  Fly   128 PTLSLSSDKEKPVAVLLGNSITCNLYLISTHRFAAQTSGYHEQLVTVFKNMPTKCYDGQTRIWSF 192

  Fly  1315 D--PLQARKTR-------------DREFLDYLFNPKSIPNYKVPVPI----SVELRCYQQAGINW 1360
            |  ..|:.||.             .::.||....|..:|...|...|    :.:|..:||.|:.:
  Fly   193 DLSDYQSLKTHAADLKPYVHMNGIPKKVLDLCGQPPVVPERSVLASIEPKLADQLMPFQQDGVCF 257

  Fly  1361 LWFLNKYNLHGILCDDMGLGKTLQTICILAGDHMHRQTANLANLPSLVICPPTLTGHWVYEVEKF 1425
            . ...|..:  ::||:||||||.|.:.:  .|:..      .:.|.||....:....|...:...
  Fly   258 A-IAQKGRI--MICDEMGLGKTYQALAV--ADYFK------DDWPLLVCTTASTRDSWAKHIMDL 311

  Fly  1426 LDQGSVLRPLHYYGFPVGREKLRSD---IGTKCNLVVASYDTVRKDIDFFSGIHFNYCVLDEGHI 1487
            |.:    .|:||.      :.|.::   :| :..:::.||:.:.:..|......|.:.:.||.|.
  Fly   312 LPK----VPIHYV------QVLNNNQLYVG-EAKVLITSYNMMERHEDKLMQRKFGFIIFDESHT 365

  Fly  1488 IKNGKTKSSKAIKRL--KANHRLILSGTPIQNNVLELWSLFDFLMPGFLGTEKQFVQRF--SRPI 1548
            :||.|.|.:...|||  :|...::|||||..:..|||::....:...|:.. .:|..|:  .:..
  Fly   366 LKNSKAKCTTTAKRLTDQAKRVVLLSGTPALSRPLELFTQLQMIDGKFMNF-MEFTTRYCDGKQS 429

  Fly  1549 LSSRDAKSSAKEQEAGVLAMEALHRQVLPFLLRRVKEDVLKDLPPKITQDLLCELSPLQLRLYED 1613
            ....||...:..:|..|:    ||   |.::|||.|.:||..|..|..:.::  |.|..:     
  Fly   430 TFGWDANGQSNLEELKVI----LH---LKYMLRRTKVEVLPQLAEKNRETVV--LDPALV----- 480

  Fly  1614 FSNKHLKDCLDKLGD--SSSASMVTENLSAKTHIFQALRYLQNVCNHPKLVLRQSEELTKVTSQL 1676
            ::|...|:.||....  .::....||.:..:.:...|....:.||.:.|.::::           
  Fly   481 WTNAETKETLDAFNKELKTAKGRATEEILLRFYARTAEVKTRAVCAYLKTLVKE----------- 534

  Fly  1677 ALSNSSLDDIEHSAKLPALKQLLLDCGIGVQTESVSQHRALIFCQLKAMLDIVEQDL--LRRHLP 1739
                                                |.:.:||...:.|:|.:...|  |:.|  
  Fly   535 ------------------------------------QKKFIIFAHHRVMMDAISDFLSGLKVH-- 561

  Fly  1740 SVTYLRLDGSVPASQRQDIVNNFNSDPSIDVLLLTTMVGGLGLNLTGADTVIFVEHDWNPMKDLQ 1804
               |:|:||...:..|.|.|:.|....|..|.||:......|:.||.|:.::|.|.||||....|
  Fly   562 ---YIRIDGQTRSDHRSDSVDTFQKKSSCKVALLSLKACNSGITLTAAEIIVFAELDWNPSTLAQ 623

  Fly  1805 AMDRAHRIGQKKVVNVYRLITRNSLEEKIMGLQKFKILTANTV-VSAENASLQT 1857
            |..|||||||.|.|....||..|:.::.|..:.|.|....:.| :.|||....|
  Fly   624 AESRAHRIGQTKPVICRYLIAHNTADDIIWNMLKNKQEVLSKVGIFAENLQKAT 677

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hel89BNP_001287351.1 HEAT repeat 5..30 CDD:293787
HEAT repeat 42..70 CDD:293787
HEAT repeat 395..420 CDD:293787
HEAT repeat 433..465 CDD:293787
HEAT repeat 475..504 CDD:293787
HEAT repeat 516..540 CDD:293787
HEAT repeat 560..589 CDD:293787
DUF3535 654..1138 CDD:288874
HEAT repeat 1234..1261 CDD:293787
HEAT repeat 1269..1298 CDD:293787 11/42 (26%)
SNF2_N 1353..1662 CDD:278600 77/318 (24%)
DEXDc 1370..1514 CDD:238005 39/149 (26%)
Helicase_C 1689..1813 CDD:278689 37/126 (29%)
Marcal1NP_608883.1 HARP 160..215 CDD:284784 13/55 (24%)
DEXDc 239..420 CDD:214692 51/204 (25%)
DEXDc 265..394 CDD:238005 39/150 (26%)
Helicase_C 518..632 CDD:278689 40/166 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C138573882
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.