DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hel89B and Smarcad1

Sequence 1:NP_001287351.1 Gene:Hel89B FlyBaseID:FBgn0022787 Length:1923 Species:Drosophila melanogaster
Sequence 2:NP_001101334.2 Gene:Smarcad1 RGDID:1309640 Length:1024 Species:Rattus norvegicus

Alignment Length:952 Identity:265/953 (28%)
Similarity:410/953 (43%) Gaps:217/953 (23%)


  Fly  1019 LETLKQT-PVSSEVINNCVYYGILTLALQQTVTTTNTRSGAGGATTPTATTAPRGPGRPPTGEIL 1082
            |:|||:. |..|:            ..|.:.:.:|:|..||..|.......|..||.:   .::.
  Rat   161 LQTLKELFPQRSD------------SDLLKLIDSTSTMDGAIAAALLKFGDAGGGPRK---RKLS 210

  Fly  1083 SATNATAHIELKAQQA-------------KEAEAKQCRIQRLGAACAIEKLCRIFGEQIIEKVAV 1134
            |::.|....|....|:             :.|||.....::......::|....|.:|.:.:|  
  Rat   211 SSSEAYEEDEANDDQSLKKPRGDRREESNESAEASSNWEKQESIVLKLQKEFPNFDKQELREV-- 273

  Fly  1135 FQHLMFGKVEQFVKEAYDWRLGSLLPDLGV--------C---------NELVSSMQLIETAAPHL 1182
                        :|| ::|.....|..|.|        |         .|:..:....:.||.  
  Rat   274 ------------LKE-HEWMYTEALESLKVFAEDQDVQCASQSEVTNGKEVARNQNYSKNAAK-- 323

  Fly  1183 HVALHPQMFALLPSLGF------IVCHPLKAVRHMAARCIAVLAEID--------------ACQT 1227
              ....|..::.|..||      .|.:|.|||..         :|.|              :|:.
  Rat   324 --IKMKQKISMKPQNGFNKKRKKNVFNPKKAVED---------SEYDSGSDAGSSLDEDYSSCEE 377

  Fly  1228 MQFVVHDLLPLLGKIEQLIERQGAIEAIERVVSRLQIKVVPYIVLLVVPLLGAMSDPDESVRLLS 1292
               |:.|  ...|||...::.....|                  |.::|    .....::.:::.
  Rat   378 ---VMED--GYKGKILHFLQDASIGE------------------LTLIP----KCSQKKAQKIIE 415

  Fly  1293 THCFANLVQLMPLDGKTEQLKSDPLQARKT--RDREFLDYLFNP-KSIPN--------------- 1339
            ...|.|...|.....|...|..|.:...||  ::|:.:..|.|. :.|.|               
  Rat   416 LRPFNNWETLFTKMSKINGLSEDLIWNCKTVIQERDVVIRLMNKCEDISNKLTKQVTMLTGNGGG 480

  Fly  1340 YKVPVPI----SVELRCYQQAGINWLWFLNKYNLHGILCDDMGLGKTLQTICILAGDHMHRQTAN 1400
            :.:..|.    |:.|:.||:.|:|||..::|:.|:|||.|:||||||:|.|..||  ::. |..|
  Rat   481 WNIEQPSLLNQSLSLKPYQKVGLNWLALVHKHGLNGILADEMGLGKTIQAIAFLA--YLF-QEGN 542

  Fly  1401 LANLPSLVICPPTLTGHWVYEVEKFLDQGSVLRPLHYYGFPVGREKLRSDIGTK---CNLVVASY 1462
            ..  |.|::.|.:...:|:.||..:.   ..|..|.|||....|:::|.:|..|   .|::|.:|
  Rat   543 KG--PHLIVVPASTIDNWLREVNLWC---PTLNVLCYYGSQEERKQIRFNIHNKYEDYNVIVTTY 602

  Fly  1463 D---TVRKDIDFFSGIHFNYCVLDEGHIIKNGKTKSSKAIKRLKANHRLILSGTPIQNNVLELWS 1524
            :   :...|...|..:..||.:.||||::||..:...:.:..:.|.:||:|:|||:|||:|||.|
  Rat   603 NCAISSSDDRSLFRRLKLNYAIFDEGHMLKNMGSIRYQHLMTINARNRLLLTGTPVQNNLLELMS 667

  Fly  1525 LFDFLMPGFLGTEKQFVQRFSRPILSSRDAKSSAKEQEAGVLAMEALHRQVL-PFLLRRVKEDVL 1588
            |.:|:||....:....::|    :.||:  ...|.||........|..:|:: ||:||||||:||
  Rat   668 LLNFVMPHMFSSSTSEIRR----MFSSK--TKPADEQSIYEKERIAHAKQIIKPFILRRVKEEVL 726

  Fly  1589 KDLPPKITQDLLCELSPLQLRLYEDFSNKHLKDCLDKLGDSSSASMVTENLSAKTHIFQALRYLQ 1653
            |.||||..|..||.:|..|.:||....|: ||..::             ||...|.:...:..|:
  Rat   727 KLLPPKKDQIELCAMSEKQEQLYSGLFNR-LKKSIN-------------NLEKNTEMCNVMMQLR 777

  Fly  1654 NVCNHPKLVLRQ--SEELTKVTSQLAL-------SNSSL--DDIE---------------HSAKL 1692
            .:.||| |:.||  :.|..|..|||.|       :|..|  :|:|               |....
  Rat   778 KMANHP-LLHRQYYTAEKLKEMSQLMLKEPTHCEANPDLIFEDMEVMTDFELHVLCKQYQHINSY 841

  Fly  1693 PALKQLLLDCG----IGVQTESVSQ--HRALIFCQLKAMLDIVEQDLLRRHLPSVTYLRLDGSVP 1751
            .....|:||.|    :|.....:.|  .|.::|.|...||||:|. ||:.|  ...||||||...
  Rat   842 QLDMDLILDSGKFRTLGCILSELKQKGDRVVLFSQFTMMLDILEV-LLKHH--QHRYLRLDGKTQ 903

  Fly  1752 ASQRQDIVNNFNSDPSIDVLLLTTMVGGLGLNLTGADTVIFVEHDWNPMKDLQAMDRAHRIGQKK 1816
            .|:|..:::.||:|..|.|.||:|..||||:|||.|:.||..:.|.||..|.||.||.||:||.|
  Rat   904 ISERIHLIDEFNTDMDIFVFLLSTKAGGLGINLTSANVVILHDIDCNPYNDKQAEDRCHRVGQTK 968

  Fly  1817 VVNVYRLITRNSLEEKIMGL--QKFKI-LTANTVVSAENASL 1855
            .|.|.:||::.::||.::.:  ||.|: ....||..|:..|:
  Rat   969 EVLVIKLISQGTIEESMLKINQQKLKLEQDMTTVDEADEGSM 1010

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hel89BNP_001287351.1 HEAT repeat 5..30 CDD:293787
HEAT repeat 42..70 CDD:293787
HEAT repeat 395..420 CDD:293787
HEAT repeat 433..465 CDD:293787
HEAT repeat 475..504 CDD:293787
HEAT repeat 516..540 CDD:293787
HEAT repeat 560..589 CDD:293787
DUF3535 654..1138 CDD:288874 26/133 (20%)
HEAT repeat 1234..1261 CDD:293787 5/27 (19%)
HEAT repeat 1269..1298 CDD:293787 3/29 (10%)
SNF2_N 1353..1662 CDD:278600 111/316 (35%)
DEXDc 1370..1514 CDD:238005 50/150 (33%)
Helicase_C 1689..1813 CDD:278689 53/130 (41%)
Smarcad1NP_001101334.2 SNF2_N 498..785 CDD:278600 111/316 (35%)
DEXDc 515..657 CDD:238005 50/150 (33%)
DEGH box. {ECO:0000250} 626..629 3/3 (100%)
Nuclear localization signal. {ECO:0000255} 719..736 13/17 (76%)
Helicase_C 851..965 CDD:278689 50/117 (43%)
DEAD box. {ECO:0000255|PROSITE-ProRule:PRU00541} 1003..1006 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D61251at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.