DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hel89B and Hells

Sequence 1:NP_001287351.1 Gene:Hel89B FlyBaseID:FBgn0022787 Length:1923 Species:Drosophila melanogaster
Sequence 2:NP_032260.2 Gene:Hells MGIID:106209 Length:821 Species:Mus musculus

Alignment Length:662 Identity:207/663 (31%)
Similarity:312/663 (47%) Gaps:145/663 (22%)


  Fly  1325 REFLDYLFNPKSIPNYKVPVPISVE-------LRCYQQAGINWLWFLNKYNLHGILCDDMGLGKT 1382
            |:...:.|:|....|.: |||....       :|.||..|:.||..|.:..::|||.|:||||||
Mouse   175 RQNSKFFFDPVRKCNGQ-PVPFQQPKHFTGGVMRWYQVEGMEWLRMLWENGINGILADEMGLGKT 238

  Fly  1383 LQTICILA--------GDHMHRQTANLANLPSLVICPPTLTGHWVYEVEKFLDQGSVLRPLHYYG 1439
            :|.|..:|        |             |.||..|.:...:|:.|.::|..:   :..|.|:|
Mouse   239 VQCIATIALMIQRGVPG-------------PFLVCGPLSTLPNWMAEFKRFTPE---IPTLLYHG 287

  Fly  1440 FPVGREKLRSDIGTKCN------LVVASYDTVRKDIDFFSGIHFNYCVLDEGHIIKNGKTKSSKA 1498
            ....|.||..:|..:..      :||.|::...:|.:.....::.|.::||||.|||.|.:..:.
Mouse   288 TREDRRKLVKNIHKRQGTLQIHPVVVTSFEIAMRDQNALQHCYWKYLIVDEGHRIKNMKCRLIRE 352

  Fly  1499 IKRLKANHRLILSGTPIQNNVLELWSLFDFLMPGFLGTEKQFVQRFSRPILSSRDAKSSAKEQEA 1563
            :||..|:::|:|:|||:|||:.|||||.:||:|......|.|...|....||.......|||:|.
Mouse   353 LKRFNADNKLLLTGTPLQNNLSELWSLLNFLLPDVFDDLKSFESWFDITSLSETAEDIIAKEREQ 417

  Fly  1564 GVLAMEALHRQVLPFLLRRVKEDVLKDLPPK---ITQDLLC------------------------ 1601
            .||.|  ||:.:.||||||:|.||..::|||   :....||                        
Mouse   418 NVLHM--LHQILTPFLLRRLKSDVALEVPPKREVVVYAPLCNKQEIFYTAIVNRTIANMFGSCEK 480

  Fly  1602 ---ELSPL---QLRLYEDFSNKHLKDC---LDKLGD------SSSASMVTENLSAKTHIFQALR- 1650
               ||||.   :.|..:..:...|...   |:||..      :...::|..|:..::.:...|| 
Mouse   481 ETVELSPTGRPKRRSRKSINYSELDQFPSELEKLISQIQPEVNRERTVVEGNIPIESEVNLKLRN 545

  Fly  1651 ---YLQNVCNHPKLVLRQSEELT---KVTSQLALSNSS----LDDIEHSAKLPALKQLLLDCGIG 1705
               .|:..||||.::....:.:|   |:..:| ::||.    ||.:     ||.||:        
Mouse   546 IMMLLRKCCNHPYMIEYPIDPVTQEFKIDEEL-VTNSGKFLILDRM-----LPELKK-------- 596

  Fly  1706 VQTESVSQHRALIFCQLKAMLDIVEQDLLRRHLPSVTYLRLDGSVPASQRQDIVNNFNSDPSIDV 1770
                  ..|:.|:|.|:.:||||: .|..  ||.:..:.|||||:..|:|:..:.:||:||.:.:
Mouse   597 ------RGHKVLVFSQMTSMLDIL-MDYC--HLRNFIFSRLDGSMSYSEREKNIYSFNTDPDVFL 652

  Fly  1771 LLLTTMVGGLGLNLTGADTVIFVEHDWNPMKDLQAMDRAHRIGQKKVVNVYRLITRNSLEEKIMG 1835
            .|::|..||||:|||.|||||..:.||||..||||.||.|||||.|.|.||||:|.|::::||:.
Mouse   653 FLVSTRAGGLGINLTAADTVIIYDSDWNPQSDLQAQDRCHRIGQTKPVVVYRLVTANTIDQKIVE 717

  Fly  1836 LQKFKILTANTVVSAENASLQTMGTSQIFDLFNGGKDKGAESGSSAVQGTASGGMSMNTI-IENL 1899
            .            :|....|:.:       :.:....||.:||.|         .|.|.: .:.|
Mouse   718 R------------AAAKRKLEKL-------IIHKNHFKGGQSGLS---------QSKNFLDAKEL 754

  Fly  1900 PELWSEHQYEEE 1911
            .||.....||.|
Mouse   755 MELLKSRDYERE 766

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hel89BNP_001287351.1 HEAT repeat 5..30 CDD:293787
HEAT repeat 42..70 CDD:293787
HEAT repeat 395..420 CDD:293787
HEAT repeat 433..465 CDD:293787
HEAT repeat 475..504 CDD:293787
HEAT repeat 516..540 CDD:293787
HEAT repeat 560..589 CDD:293787
DUF3535 654..1138 CDD:288874
HEAT repeat 1234..1261 CDD:293787
HEAT repeat 1269..1298 CDD:293787
SNF2_N 1353..1662 CDD:278600 112/369 (30%)
DEXDc 1370..1514 CDD:238005 48/158 (30%)
Helicase_C 1689..1813 CDD:278689 53/124 (43%)
HellsNP_032260.2 SNF2_N 209..560 CDD:278600 112/369 (30%)
DEXDc 226..368 CDD:238005 48/158 (30%)
helicase domain I 226..238 9/12 (75%)
helicase domain Ia 258..266 3/8 (38%)
helicase domain II 334..341 4/7 (57%)
helicase domain III 363..370 4/7 (57%)
helicase domain IV 429..439 8/10 (80%)
SrmB <546..802 CDD:223587 92/273 (34%)
helicase domain IVa 547..559 5/12 (42%)
Helicase_C 581..695 CDD:278689 56/136 (41%)
'helicase domain IVb 602..609 3/7 (43%)
helicase domain V 655..668 8/13 (62%)
helicase domain VI 686..693 5/7 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D61251at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.