DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hel89B and LOC101732236

Sequence 1:NP_001287351.1 Gene:Hel89B FlyBaseID:FBgn0022787 Length:1923 Species:Drosophila melanogaster
Sequence 2:XP_004920434.3 Gene:LOC101732236 ID: Length:153 Species:Xenopus tropicalis

Alignment Length:79 Identity:21/80 (26%)
Similarity:34/80 (43%) Gaps:10/80 (13%)


  Fly   576 SSVRRSTLKTLMTLTSADRVKSEPKDENQVKE--EADKEEMKLNFGVSDWKWELLQQALRHIYQR 638
            ||:|..::.|..:|.:.:......|.:..:.|  |..|.|.|.|:.|..:    .:.|||....|
 Frog    11 SSLRNFSVDTETSLYNFEGEDYREKQKLSMMEWIEPPKRERKANYAVDAY----FRDALRVSEPR 71

  Fly   639 ILVEP----QADIQ 648
            :...|    |.:||
 Frog    72 VPKAPRPPKQPNIQ 85

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hel89BNP_001287351.1 HEAT repeat 5..30 CDD:293787
HEAT repeat 42..70 CDD:293787
HEAT repeat 395..420 CDD:293787
HEAT repeat 433..465 CDD:293787
HEAT repeat 475..504 CDD:293787
HEAT repeat 516..540 CDD:293787
HEAT repeat 560..589 CDD:293787 4/13 (31%)
DUF3535 654..1138 CDD:288874
HEAT repeat 1234..1261 CDD:293787
HEAT repeat 1269..1298 CDD:293787
SNF2_N 1353..1662 CDD:278600
DEXDc 1370..1514 CDD:238005
Helicase_C 1689..1813 CDD:278689
LOC101732236XP_004920434.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D61251at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.