DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbf2 and Rbl2

Sequence 1:NP_524372.1 Gene:Rbf2 FlyBaseID:FBgn0038390 Length:783 Species:Drosophila melanogaster
Sequence 2:XP_006255261.1 Gene:Rbl2 RGDID:3541 Length:1136 Species:Rattus norvegicus

Alignment Length:1050 Identity:218/1050 (21%)
Similarity:367/1050 (35%) Gaps:366/1050 (35%)


  Fly    15 RRFSVSCEQLELEARIQQSALSTYHRLDAVNGLSTSEADAQEWLCCAVYSELQRSKMRDIRESIN 79
            :||...|.:|.::...:..|.|:|.   :::...|.|.:...||.||:|...::| :..:.:...
  Rat    44 QRFEELCSRLNMDEAARAEAWSSYR---SMSESYTLEGNDLHWLACALYVACRKS-VPTVSKGTA 104

  Fly    80 EANDSVAKNCCWNVSLTRLLRSFKMNVSQFLRRMEHWNWLTQNENTFQLEVEELRCRLGITSTLL 144
            |.|         .|||||:||..:.::.:|..:|:.|..:......|:...|.|.....:::.:.
  Rat   105 EGN---------YVSLTRILRCSEQSLIEFFNKMKKWEDMANLPPHFRERTERLERNFTVSAVIF 160

  Fly   145 RHYKHIFRSLFVHPGKGADP----GAANHYQ-----ALYEFGWLLFLVIRNELPGFAITNLINGC 200
            :.|:.||:.:|.:| :...|    |.....|     .::.|.|:||:..:...|..: .:|:|..
  Rat   161 KKYEPIFQDIFKYP-QEEQPRQQRGRKQRRQPCTTSEIFHFCWVLFIYAKGNFPMIS-DDLVNSY 223

  Fly   201 QVLVCTMDLLFVNALEVP-RSVVIRREFSGVPKNWDTEDFNPILLNKYSVLEALGELIP--ELPA 262
            .:|:|.:||::.|||:.. |..::...|.||.::....|.:| ..:...|:|.|..|..  .|.|
  Rat   224 HLLLCALDLVYGNALQCSNRKELVNPNFKGVSEDGHPRDSHP-SSDPPCVIEKLCSLHDGLVLEA 287

  Fly   263 KGVVQMKNAFFHKALIMLYMDHSLVGDDTHMREIIKEGMLDINLENLNRKYTNQVADISEMDERV 327
            ||:   |..|:...:..|:....|.|.:.::...::.|....:.:.:|:.|...|.....:|||:
  Rat   288 KGI---KQHFWKPYIRKLFEKKLLRGKEENLTGFLEPGNFAESFKAVNKAYEEYVLATGSLDERI 349

  Fly   328 LLSVQGAIETKGDSPKSPQLAFQTSS-----------------------------------SPSH 357
            .|. :.|.|..|...:....|..|.|                                   ||..
  Rat   350 FLG-EDAEEEVGTLSRCVSAASGTESAERTQMRDILQQHLDKSKTLRVCNPLTGVRYVQENSPCV 413

  Fly   358 RKLS--THDLPASLPLSIIKAFPKKEDADKIVNYLDQTLEEMNRTFTMAVKDFL----------- 409
            ..:|  ||.|..   |..:.|..:...::|    |:|.|...:|..|.|:.|.|           
  Rat   414 TPVSTATHSLNR---LHTMLAGLRNAPSEK----LEQILRSCSRDPTRAIADRLREMYEIYSQHF 471

  Fly   410 ---------DAELSGKRFRQARGLYYKYLQKILGPELVQKPQLKIGQLMKQRKLTAALLACCLEL 465
                     ..|::.|.||.|..||||.|:.::..|..:...:.:..:::|.....:|||||||:
  Rat   472 QPDENVSNCAKEMANKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGVLEQDAFHKSLLACCLEV 536

  Fly   466 ALHVHHKLVEGLRFPFVLHCFSLDAYDFQKILELVVRYDHGFLGRELIKHLDVVEEMCLDSLIFR 530
            ....:..  .| .|||:...|.:..|.|.|::|:.:|.:.| |.||::|||:.:||..||.|.::
  Rat   537 VAFSYKP--PG-NFPFIAEIFDVPHYHFYKVIEVFIRAEDG-LCREVVKHLNQIEEQILDHLAWK 597

  Fly   531 KSSQLWWEL---NQRLPRYKEV------------------------------------------- 549
            ..|.||..:   ..|:|..:||                                           
  Rat   598 TKSPLWDRIRDNENRVPTCEEVTPPHNLERTDEIYIAGSPLTPRRVGEVRTDAGGLGRSVTSPTT 662

  Fly   550 --------------------DAETEDK----------------ENFS------------------ 560
                                |:.:|..                :|.|                  
  Rat   663 LYDRYSSPTVSTTRRRLFESDSPSEGSTAGRIPPQPLVNAVPVQNVSGETVSVTPVPGQTLVTMA 727

  Fly   561 ------------------------------------------TGS-------------------- 563
                                                      |||                    
  Rat   728 TATVTANNGQTVTIPVQGIANENGGITFFPVQVNVGGQAQAVTGSIQPLSAQALAGSLSSQQVTG 792

  Fly   564 ----------------------------------------SICLRKFYGLANRRLLLLCKSLCLV 588
                                                    |:..||.|.||..||..||..|.:.
  Rat   793 TTLQVPGPVAIQQISPGGQQQNQGQPLTSSSIRPRKTSSLSLFFRKVYYLAGVRLRDLCTKLDIS 857

  Fly   589 DSF-PQIWHLAEHSFTLESSRLLRNRHLDQLLLCAIHLHVRLEKLHLTFSMIIQHYRRQPHFRRS 652
            |.. .:||...|.|. ::...|:.:|||||||:|||::..::.|...:|..|::.||.||..|..
  Rat   858 DELRKKIWTCFEFSI-VQCPELMMDRHLDQLLMCAIYVMAKVTKEDKSFQNIMRCYRTQPQARSQ 921

  Fly   653 AYREVSLGNGQTADIITFYNSVYVQSMGNYGRHLECAQTRKSLEESQSNVGILTETTSNELS--- 714
            .||.|.:...:.                |.|   .|        |::|:....||..::..|   
  Rat   922 VYRSVLIKGKRR----------------NSG---SC--------ENRSHQNSPTELNTDRASRDS 959

  Fly   715 ---MRANISISSPPPPRVCQSGSCSSHPPSSPAASPLSLQSSPNVKRAASSNDLMREIKRPNILR 776
               ||:|.::..|.|         ||.||:.              .|...:|..:.|.:|.::::
  Rat   960 SPVMRSNSTLPVPQP---------SSAPPTP--------------TRLTGANSDIEEEERGDLIQ 1001

  Fly   777 ------RRQL 780
                  |:|:
  Rat  1002 FYNNIYRKQI 1011

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbf2NP_524372.1 DUF3452 83..210 CDD:288762 32/136 (24%)
RB_A 380..536 CDD:280101 52/176 (30%)
CYCLIN 564..679 CDD:294043 38/116 (33%)
Rbl2XP_006255261.1 DUF3452 101..233 CDD:288762 34/143 (24%)
Effector_1 <323..>433 CDD:282387 21/114 (18%)
RB_A 414..606 CDD:280101 59/203 (29%)
RB_B 831..1011 CDD:280100 61/231 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C16888614
eggNOG 1 0.900 E1_KOG1010
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D113612at2759
OrthoFinder 1 1.000 FOG0002032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13742
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
76.810

Return to query results.
Submit another query.