DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbf2 and rbl1

Sequence 1:NP_524372.1 Gene:Rbf2 FlyBaseID:FBgn0038390 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_001124082.1 Gene:rbl1 ZFINID:ZDB-GENE-030131-8179 Length:1058 Species:Danio rerio

Alignment Length:1053 Identity:225/1054 (21%)
Similarity:375/1054 (36%) Gaps:332/1054 (31%)


  Fly     2 ETCEVEGEAETLVRRFSVSCEQLELEARIQQSALSTYHRLDAVNGLSTSEADAQEWLCCAVYSEL 66
            :|..|.....::...|...|::|.::......||..:.   ::....|.|.|...||.|::|:..
Zfish     7 DTESVRSADGSIRSNFEALCQELNMDEETAAEALQNFR---SIWNTYTLEGDVMHWLACSLYAAC 68

  Fly    67 QRSKMRDIRESINEANDSVAKNCCWNVSLTRLLRSFKMNVSQFLRRMEHWNWLTQNENTFQLEVE 131
            ::|.:..:...:.|.|       |  |||||:|||.|:::.||..:|:.|:.:......|:..:.
Zfish    69 RKSSIPTVGRGVMEGN-------C--VSLTRILRSAKLSLIQFFSKMKKWSDMANLCQDFRSRIG 124

  Fly   132 ELRCRLGITSTLLRHYKHIFRSLFVHPGKGADPGAAN---------HYQALYEFGWLLFLVIRNE 187
            .|.....:::.:.|.::.||..:|.:| :...|....         |...:::|.|.||:..:..
Zfish   125 RLERNFEVSTVIFRKFEPIFLDMFQNP-QSEPPRMPRSRKHRRLPCHISDVFKFCWTLFVYTKGN 188

  Fly   188 LPGFAITNLINGCQVLVCTMDLLFVNALEVP-RSVVIRREFSGVPKNWDTEDFN--PILLNKYSV 249
            ..... .:|:|...:|:|.:||:|.|||... |..:|.:.|.|:||  |||:..  |.:::|  :
Zfish   189 FHMIG-DDLVNSYHLLLCCLDLVFCNALMCSNRKDLINQNFRGLPK--DTENLKEMPCVIDK--L 248

  Fly   250 LEALGELIPELPAKGVVQMKNAFFHKALIMLYMDHSLVGDDTHMREIIKEGMLDINLENLNRKYT 314
            .|....|:.|  |||:   |..:|...:..|:....|.||...:.|::.......|.:.:||.|.
Zfish   249 CELHDGLVVE--AKGI---KEHYFKPYIKTLFEKRMLKGDVETLTELLDTPNFQDNNKAINRDYE 308

  Fly   315 NQVADISEMDERVLLSVQG--AIETKGDSPKSPQLAFQTSSSPSHRKLSTH-----DLPASLPLS 372
            ..|..:.:.||||.|....  .|.|...||..|.....::.......|..|     .|..|.||:
Zfish   309 EFVLTVGDFDERVFLGADADEEIGTPRKSPAEPPSGHLSARMQVENNLQQHFEKTRSLAPSTPLT 373

  Fly   373 IIKAFPKKE----------------------------DA-------------DKIVNYLDQTLEE 396
            ..:...:||                            ||             :.|:|.:....|:
Zfish   374 GRRYLKEKEVLVTPVSSATQSVSRLQSMVSGLRNAPSDALLQIFNSCSRNPTESILNRVKTLGEK 438

  Fly   397 MNRTFTMAVKDFLDA--ELSGKRFRQARGLYYKYLQKILGPELVQKPQLKIGQLMKQRKLTAALL 459
            ..:.:|....|...|  :.:.||.:.|..||:|.|:.::..|:.:........|::|..|..:||
Zfish   439 FKQAYTNPTDDLPGAHMDFAEKRLKLAEILYFKILENVMTQEMKRLQGKDWAVLLEQEVLHCSLL 503

  Fly   460 ACCLELALHVHHKLVEGLRFPFVLHCFSLDAYDFQKILELVVRYDHGFLGRELIKHLDVVEEMCL 524
            |||||:.|..:.   ....||::|..|.:..:.|.|::|:.:|.:.| |.|:::|||:.:||..|
Zfish   504 ACCLEVVLFSYS---SQRTFPWILEIFQIPPFYFYKVIEVFIRSEEG-LSRDMVKHLNSIEEQVL 564

  Fly   525 DSLIFRKSSQLWWELNQ---RLPRYKEVDAETEDKENFSTGS----------------------- 563
            :|..:.:.|.||..||:   ::|..:||:..:    ||.||:                       
Zfish   565 ESRAWTRDSALWNALNKDNNKVPTVEEVNFPS----NFDTGNNAGGPTHLPLVALSPIIHPRLRE 625

  Fly   564 ----------------------------------------------------------------- 563
                                                                             
Zfish   626 VRTGLGSSARKDVPQSPISLHDRYSSPAAGSAKRRLFGDDAPPQSPVKRISVTPIKIIPSGMENQ 690

  Fly   564 ----------------------------------------------------------------- 563
                                                                             
Zfish   691 TTTTTVLSMATGNGQQLTIPLPVVKNEAGGITVIQLQASDMNPLTAQVLLTASPSRPALAAPAIS 755

  Fly   564 -----------------SICLRKFYGLANRRLLLLCKSLCLVDSF-PQIWHLAEHSFTLESSRLL 610
                             ::..||.|.||:.||..||..|.:.... .:||...|||. |..:.|:
Zfish   756 SDSQPPPANKPRRTGSLALFFRKVYHLASVRLRDLCLKLDISSELRGKIWTCFEHSL-LHCTDLM 819

  Fly   611 RNRHLDQLLLCAIHLHVRLEKLHLTFSMIIQHYRRQPHFRRSAYREVSL---------------- 659
            ::||||||||||:::..|:.|...||..|::.||.||......||.|.:                
Zfish   820 KDRHLDQLLLCAVYIISRITKEEHTFQDIMKCYRTQPQANSHVYRSVLIKRRPKVQQADENMEVD 884

  Fly   660 -------------GNGQT---------------ADIITFYNSVYVQSMGNYGRHLECAQTRKSLE 696
                         .|.:|               .|:|.|||::||..|.::......:.....:|
Zfish   885 PPADQSNERTDQAANERTDQADRTQTVFESEERGDLIQFYNNIYVSKMRSFAFKYALSTLDNRME 949

  Fly   697 ESQSNVGILTETTSNELSMRANISISSPPPPRVCQSGS--CSSHPPSS----PAASPLSLQSSPN 755
                         :..||...::...:..|.||.|..|  .|.|..||    ..|.......||:
Zfish   950 -------------APPLSPFPSVRSHTLSPRRVSQKHSIFVSPHKNSSSLTPSTAYTYRFTGSPS 1001

  Fly   756 VKRAASSNDLMRE 768
             |..:..|.::|:
Zfish  1002 -KELSDINQMIRQ 1013

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbf2NP_524372.1 DUF3452 83..210 CDD:288762 33/136 (24%)
RB_A 380..536 CDD:280101 49/199 (25%)
CYCLIN 564..679 CDD:294043 48/160 (30%)
rbl1NP_001124082.1 DUF3452 79..210 CDD:288762 35/142 (25%)
RB_A 386..579 CDD:280101 48/197 (24%)
RB_B 771..932 CDD:280100 48/162 (30%)
Rb_C 951..>1041 CDD:286075 17/65 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C16889301
eggNOG 1 0.900 E1_KOG1010
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D113612at2759
OrthoFinder 1 1.000 FOG0002032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13742
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.