DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbf2 and Rb1

Sequence 1:NP_524372.1 Gene:Rbf2 FlyBaseID:FBgn0038390 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_058741.1 Gene:Rb1 RGDID:3540 Length:920 Species:Rattus norvegicus

Alignment Length:869 Identity:175/870 (20%)
Similarity:335/870 (39%) Gaps:227/870 (26%)


  Fly    17 FSVSCEQLELEARIQQSALSTYHRLDAVNGLSTS--EADAQEWLCCAVYSELQRSKMRDIRESIN 79
            |...|::|::...:::.|..|:.::.:|:|:...  :...:.|..|...:.:...:|        
  Rat    50 FIALCQKLKVPDHVRERAWLTWEKVSSVDGILEGYIQKKKELWGICIFIAAVDLDEM-------- 106

  Fly    80 EANDSVAKNCCWNVSLTRLLRSFKMNVSQFLRRMEHWNWLTQNENTFQLEVEELRCRLGITSTLL 144
                        ..:.|.|.:|.:.:|.:|...::..:..|:.:|.....:::......:.|.|.
  Rat   107 ------------PFTFTELQKSIETSVYKFFDLLKEIDTSTKVDNAVSRLLKKYNVLCALYSKLE 159

  Fly   145 RHYKHIFRSLFVHPGKGADPGAANHYQALYEFGWLLFLVIRNELPGFAITNLINGCQVLVCTMDL 209
            |....|:   ...|..|.  ....:...:.:..|:.||:.:.|:.... .:|:...|:::|.:|.
  Rat   160 RTCGLIY---LTQPSSGL--STEINSMLVLKVSWITFLLAKGEVVQME-DDLVISFQLMLCVLDY 218

  Fly   210 LFVNALEVPRSVVIRREF--SGVPKNWDTEDFNPILLNKYSVLEALGELIPELPAKGVVQMKNAF 272
            .    :::....::|..:  :..|.|..                      |..|.:|  |.::|.
  Rat   219 F----IKLSPPALLREPYKTAATPINGS----------------------PRTPRRG--QNRSAR 255

  Fly   273 FHKAL-------IMLYMDHSLVGDD---THMREII----KEGMLDIN----LENLNRKYTNQVAD 319
            ..|.|       .:|..:|....|:   .:.:..|    ..|::..|    ||:|:::|......
  Rat   256 IAKQLESDTRTIEVLCKEHECNVDEVKNVYFKNFIPFISSLGIVSSNGLPELESLSKRYEEVYLK 320

  Fly   320 ISEMDERVLLSVQGAIETKGDSPKSPQLAFQTSSSPSHRKLSTHDLPASL--------------- 369
            ..::|.|:.|.....::|  |:..|    |:|..:|  || |..|..|::               
  Rat   321 SKDLDARLFLDHDKTLQT--DTIDS----FETERTP--RK-SNPDEEANMVTPHTPVRTVMNTIQ 376

  Fly   370 PLSIIKAFPKKEDADKIVNYLDQTLEEMNRTFTMAVKD--------FLDA------ELSGKRFRQ 420
            .|.:|......:.::.:::|...............|||        |..|      ::..:|::.
  Rat   377 QLMVILNSASDQPSENLISYFSNCTVNPKENILKRVKDVGHIFKEKFASAVGQGCIDIGAQRYKL 441

  Fly   421 ARGLYYKYLQKILGPELVQKPQLKIGQLMKQRKLTAALLACCLELALHVHHK-----LVEG--LR 478
            ...|||:.::.:|..|..:.......:|:.......:||||.||:.:..:.:     |..|  |.
  Rat   442 GVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSMLQNLDSGTDLS 506

  Fly   479 FPFVLHCFSLDAYDFQKILELVVRYDHGFLGRELIKHLDVVEEMCLDSLIFRKSSQLWWELNQ-- 541
            ||::|:..:|.|:||.|::|..::.:.. |.||:||||:..|...::||.:...|.|:..:.|  
  Rat   507 FPWILNVLNLKAFDFYKVIESFIKVEAN-LTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSK 570

  Fly   542 --------------------------------RLPRYK--------EVDAETEDKENF------- 559
                                            |.|:.:        ..:.||:....|       
  Rat   571 DGEGPDHLESACSLSLPLQSNHTAADMYLSPIRSPKKRTSTTRVNSAANTETQAASAFHTQKPLK 635

  Fly   560 STGSSICLRKFYGLANRRLLLLCKSLCLVDSFPQ--IWHLAEHSFTLESS-RLLRNRHLDQLLLC 621
            ||..|:..:|.|.||..||..||..|......|:  ||.|.:|  |||:. .|:::|||||:::|
  Rat   636 STSLSLFYKKVYRLAYLRLNTLCARLLSDHPEPEHIIWTLFQH--TLENEYELMKDRHLDQIMMC 698

  Fly   622 AIHLHVRLEKLHLTFSMIIQHYRRQPHFRRSAYREVSLGNGQTADIITFYNSVYVQSMGNYGRHL 686
            :::...:::.:.|.|.:|:..|:..||..:..::.|.:...:...||.|||||::|.:       
  Rat   699 SMYGICKVKNIDLKFKIIVTAYKDLPHAAQETFKRVLIREEEFDSIIVFYNSVFMQRL------- 756

  Fly   687 ECAQTRKSLEESQSNVGILTETTSNELSMRANISISSPPPPRVCQSGSCSSHPPSSP---AASPL 748
                        ::|:                :..:|..||.:    |...|.|.||   ::|||
  Rat   757 ------------KTNI----------------LQYASTRPPTL----SPIPHIPRSPYKFSSSPL 789

  Fly   749 SLQSSPNVKRAASSNDLMREIKRP 772
                     |....|..|..:|.|
  Rat   790 ---------RIPGGNIYMSPLKSP 804

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbf2NP_524372.1 DUF3452 83..210 CDD:288762 21/127 (17%)
RB_A 380..536 CDD:280101 43/177 (24%)
CYCLIN 564..679 CDD:294043 40/118 (34%)
Rb1NP_058741.1 DUF3452 108..218 CDD:288762 21/116 (18%)
Pocket, binds T and E1A (By similarity) 366..763 94/435 (22%)
Domain A (By similarity) 366..572 46/207 (22%)
RB_A 366..566 CDD:280101 45/201 (22%)
Spacer (By similarity) 573..631 5/58 (9%)
Domain B (By similarity) 632..763 43/168 (26%)
RB_B 638..755 CDD:280100 40/119 (34%)
Interaction with LIMD1 (By similarity) 755..920 17/99 (17%)
Rb_C 760..916 CDD:286075 16/75 (21%)
Domain C, mediates interaction with E4F1 (By similarity) 763..920 16/56 (29%)
Nuclear localization signal (By similarity) 862..868
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C16889767
eggNOG 1 0.900 E1_KOG1010
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D113612at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_134617
Panther 1 1.100 O PTHR13742
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.