DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbf2 and Rbl2

Sequence 1:NP_524372.1 Gene:Rbf2 FlyBaseID:FBgn0038390 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_035380.3 Gene:Rbl2 MGIID:105085 Length:1135 Species:Mus musculus

Alignment Length:1130 Identity:228/1131 (20%)
Similarity:385/1131 (34%) Gaps:420/1131 (37%)


  Fly     5 EVEGEA-----------ETLVRRFSVSCEQLELEARIQQSALSTYHRLDAVNGLSTSEADAQEWL 58
            |.:|:|           ..:.:||...|.:|.::...:..|.|:|.   :::...|.|.:...||
Mouse    23 EEDGDAADRAQPAGSPSHQIQQRFEELCSRLNMDEAARAEAWSSYR---SMSESYTLEGNDLHWL 84

  Fly    59 CCAVYSELQRSKMRDIRESINEANDSVAKNCCWNVSLTRLLRSFKMNVSQFLRRMEHWNWLTQNE 123
            .||:|...::| :..:.:...|.|         .|||||:||..:.::.:|..:|:.|..:....
Mouse    85 ACALYVACRKS-VPTVSKGTAEGN---------YVSLTRILRCSEQSLIEFFNKMKKWEDMANLP 139

  Fly   124 NTFQLEVEELRCRLGITSTLLRHYKHIFRSLFVHPGKGADP----GAANHYQ-----ALYEFGWL 179
            ..|:...|.|.....:::.:.:.|:.||:.:|.:| :...|    |.....|     .::.|.|:
Mouse   140 PHFRERTERLERNFTVSAVIFKKYEPIFQDIFKYP-QEEQPRQQRGRKQRRQPCTTSEIFHFCWV 203

  Fly   180 LFLVIRNELPGFAITNLINGCQVLVCTMDLLFVNALEVP-RSVVIRREFSGV-----PKNWDTED 238
            ||:..:...|..: .:|:|...:|:|.:||::.|||:.. |..::...|.|:     ||:.....
Mouse   204 LFIYAKGNFPMIS-DDLVNSYHLLLCALDLVYGNALQCSNRKELVNPNFKGLSEDCHPKDSKASS 267

  Fly   239 FNPILLNKY-SVLEALGELIPELPAKGVVQMKNAFFHKALIMLYMDHSLVGDDTHMREIIKEGML 302
            ..|.::.|. |:.:.|     .|.|||:   |..|:...:..|:....|.|.:.::...::.|..
Mouse   268 DPPCVIEKLCSLHDGL-----VLEAKGI---KEHFWKPYIRKLFEKKLLKGKEENLTGFLEPGNF 324

  Fly   303 DINLENLNRKYTNQVADISEMDERVLLSVQGAIETKGDSPKSPQLAFQTSS-------------- 353
            ..:.:.:|:.|...|.....:||||.|. :.|.|..|...:....|..|.|              
Mouse   325 GESFKAVNKAYEEYVLAAGNLDERVFLG-EDAEEEVGTLSRCLSAASGTESAERTQMRDILQQHL 388

  Fly   354 ---------------------SPSHRKLST--HDLP-ASLPLSIIKAFPKKEDADKIVNYLDQTL 394
                                 ||....:||  |.|. ....||.::..|.::        |::.|
Mouse   389 DKSKALRVCTPLTGVRYVQENSPCVTPVSTAAHSLSRLHTMLSGLRNAPSEK--------LERIL 445

  Fly   395 EEMNRTFTMAVKDFLD--------------------AELSGKRFRQARGLYYKYLQKILGPELVQ 439
            ...:|..|.|:.|.|.                    .|::.|.||.|..||||.|:.::..|..:
Mouse   446 RSCSRDPTQAIADRLKEMYEIYSQHFQPDENFSNCAKEIANKHFRFAEMLYYKVLESVIEQEQKR 510

  Fly   440 KPQLKIGQLMKQRKLTAALLACCLELALHVHHKLVEGLRFPFVLHCFSLDAYDFQKILELVVRYD 504
            ...:.:..:::......:|||||||:....|..  .| .|||:...|.:..|.|.|::|:.:|.:
Mouse   511 LGDMDLSGVLEHDAFHRSLLACCLEVVAFSHKP--PG-NFPFIAEIFDVPHYHFYKVIEVFIRAE 572

  Fly   505 HGFLGRELIKHLDVVEEMCLDSLIFRKSSQLWWEL---NQRLPRYKEV----DAETEDK------ 556
            .| |.||::|||:.:||..||.|.::..|.||..:   ..|:|..:||    :.|..|:      
Mouse   573 DG-LCREVVKHLNQIEEQILDHLAWKTKSPLWDRIRDNENRVPTCEEVMPPQNLERTDEIYIAGS 636

  Fly   557 --------------------------------------------ENFS----------------- 560
                                                        ||.|                 
Mouse   637 PLTPRRVGEVRADAGGLGRSITSPTTLYDRYSSPTVSTTRRRLFENDSPSEGSTSGRIPPQPLVN 701

  Fly   561 ----------------------------------------------------------------- 560
                                                                             
Mouse   702 AVPVQNVPGETVSVTPVPGQTLVTMATATVTANNGQTVTIPVQGIANENGGITFFPVQVNVGGQA 766

  Fly   561 ------------------------TG-------------------------------------SS 564
                                    ||                                     ||
Mouse   767 QAVAGSIQPLSAQALAGSLSSQQVTGTTLQVPGPVAIQQISPGGQQQNPGQPLTSSSIRPRKTSS 831

  Fly   565 ICL--RKFYGLANRRLLLLCKSLCLVDSF-PQIWHLAEHSFTLESSRLLRNRHLDQLLLCAIHLH 626
            :.|  ||.|.||..||..||..|.:.|.. .:||...|.|. ::.:.|:.:|||||||:|||::.
Mouse   832 LALFFRKVYYLAGVRLRDLCIKLDISDELRKKIWTCFEFSI-IQCTELMMDRHLDQLLMCAIYVM 895

  Fly   627 VRLEKLHLTFSMIIQHYRRQPHFRRSAYREVSL-------GNGQT-------------------- 664
            .::.|...:|..|::.||.||..|...||.|.:       |:.::                    
Mouse   896 AKVTKEDRSFQNIMRCYRTQPQARSQVYRSVLIKGKRRNSGSSESRSHQNSPTELNTDRASRDSS 960

  Fly   665 ------------------------------------ADIITFYNSVYVQSMGNYGRHLECAQTRK 693
                                                .|:|.|||::|.:.:..:           
Mouse   961 PVMRSNSTLPVPQPSSAPPTPTRLTGASSDVEEEERGDLIQFYNNIYRKQIQAF----------- 1014

  Fly   694 SLEESQSNVGILTETTSNELSMRANISISSPPPPRVCQSGSCSSHP----PSSPAASP------- 747
            :::.||:|    .:|.:..||....:...||...::.|     |||    |.:..|.|       
Mouse  1015 AMKYSQAN----AQTDTPPLSPYPFVRTGSPRRVQLSQ-----SHPIYISPHNNEAMPSPREKIF 1070

  Fly   748 LSLQSSPNVKRAASSNDLMREIKRP 772
            ....:||: ||....|.::|..:.|
Mouse  1071 YYFSNSPS-KRLREINSMIRTGETP 1094

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbf2NP_524372.1 DUF3452 83..210 CDD:288762 32/136 (24%)
RB_A 380..536 CDD:280101 50/176 (28%)
CYCLIN 564..679 CDD:294043 46/181 (25%)
Rbl2NP_035380.3 DUF3452 101..233 CDD:288762 34/143 (24%)
Pocket, binds E1A 414..1021 118/631 (19%)
Domain A 414..613 59/211 (28%)
RB_A 414..606 CDD:280101 58/204 (28%)
Spacer 614..824 10/210 (5%)
Domain B 825..1021 49/208 (24%)
RB_B 831..1011 CDD:280100 46/181 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C16888478
eggNOG 1 0.900 E1_KOG1010
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D113612at2759
OrthoFinder 1 1.000 FOG0002032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13742
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.810

Return to query results.
Submit another query.