DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbf2 and Rb1

Sequence 1:NP_524372.1 Gene:Rbf2 FlyBaseID:FBgn0038390 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_033055.2 Gene:Rb1 MGIID:97874 Length:921 Species:Mus musculus

Alignment Length:916 Identity:176/917 (19%)
Similarity:345/917 (38%) Gaps:295/917 (32%)


  Fly     1 METCEVEGEAETLVRRFSVSCEQLELEARIQQSALSTYHRLDAVNGLSTS--EADAQEWLCCA-- 61
            :|..|:| |.|     |...|::|::...:::.|..|:.::.:|:|:...  :...:.|..|.  
Mouse    41 LEFEEIE-EPE-----FIALCQKLKVPDHVRERAWLTWEKVSSVDGILEGYIQKKKELWGICIFI 99

  Fly    62 ----------VYSELQRS------KMRDIRESINEAN--DSVAKNCCWNVSLTRLLRSFKMNVSQ 108
                      .::|||:|      |..|:.:.|:.:.  |:         :::|||:.:.:..:.
Mouse   100 AAVDLDEMPFTFTELQKSIETSVYKFFDLLKEIDTSTKVDN---------AMSRLLKKYNVLCAL 155

  Fly   109 F--LRRMEHWNWLTQNENTFQLEVEELRCRLGITSTLLRHYKHIFRSLFVHPGKGADPGAANHYQ 171
            :  |.|.....:|||..:....|:..:                                      
Mouse   156 YSKLERTCELIYLTQPSSALSTEINSM-------------------------------------- 182

  Fly   172 ALYEFGWLLFLVIRNELPGFAITNLINGCQVLVCTMDLLFVNALEVPRSVVIRREF--SGVPKNW 234
            .:.:..|:.||:.:.|:.... .:|:...|:::|.:|..    ::.....::|..:  :.:|.|.
Mouse   183 LVLKISWITFLLAKGEVLQME-DDLVISFQLMLCVVDYF----IKFSPPALLREPYKTAAIPING 242

  Fly   235 DTEDFNPILLNKYSVLEALGELIPELPAKGVVQMKNAFFHKALIMLYMDHSLVGDDTHMREII-K 298
            .                      |..|.:|  |.::|...|.|          .:||.:.|:: |
Mouse   243 S----------------------PRTPRRG--QNRSARIAKQL----------ENDTRIIEVLCK 273

  Fly   299 E-----------------------GMLDIN----LENLNRKYTNQVADISEMDERVLLSVQGAIE 336
            |                       |::..|    :|:|:::|........::|.|:.|.....::
Mouse   274 EHECNIDEVKNVYFKNFIPFINSLGIVSSNGLPEVESLSKRYEEVYLKNKDLDARLFLDHDKTLQ 338

  Fly   337 TKGDSPKSPQLAFQTSSSP------SHRKLSTHDLPASLPLSIIKAF------PKKEDADKIVNY 389
            |      .|..:|:|..:|      ....:.|...|....::.|:..      ...:.::.:::|
Mouse   339 T------DPIDSFETERTPRKNNPDEEANVVTPHTPVRTVMNTIQQLMVILNSASDQPSENLISY 397

  Fly   390 LDQTLEEMNRTFTMAVKD--------FLDA------ELSGKRFRQARGLYYKYLQKILGPELVQK 440
            .:.............|||        |.:|      ::..:|::....|||:.::.:|..|..:.
Mouse   398 FNNCTVNPKENILKRVKDVGHIFKEKFANAVGQGCVDIGVQRYKLGVRLYYRVMESMLKSEEERL 462

  Fly   441 PQLKIGQLMKQRKLTAALLACCLELALHVHHK-----LVEG--LRFPFVLHCFSLDAYDFQKILE 498
            ......:|:.......:||||.||:.:..:.:     |..|  |.||::|:..:|.|:||.|::|
Mouse   463 SIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTLQHLDSGTDLSFPWILNVLNLKAFDFYKVIE 527

  Fly   499 LVVRYDHGFLGRELIKHLDVVEEMCLDSLIFRKSSQLWWELNQ---------------------- 541
            ..::.:.. |.||:||||:..|...::||.:...|.|:..:.|                      
Mouse   528 SFIKVEAN-LTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDGEGPDNLEPACPLSLPLQG 591

  Fly   542 ------------RLPRYK--------EVDAETEDKENF-------STGSSICLRKFYGLANRRLL 579
                        |.|:.:        ..:.||:....|       ||..::..:|.|.||..||.
Mouse   592 NHTAADMYLSPLRSPKKRTSTTRVNSAANTETQAASAFHTQKPLKSTSLALFYKKVYRLAYLRLN 656

  Fly   580 LLCKSLCLVDSFPQ----IWHLAEHSFTLESS-RLLRNRHLDQLLLCAIHLHVRLEKLHLTFSMI 639
            .||..  |:...|:    ||.|.:|  ||::. .|:|:|||||:::|:::...:::.:.|.|.:|
Mouse   657 TLCAR--LLSDHPELEHIIWTLFQH--TLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKII 717

  Fly   640 IQHYRRQPHFRRSAYREVSLGNGQTADIITFYNSVYVQSMGNYGRHLECAQTRKSLEESQSNVGI 704
            :..|:..||..:..::.|.:...:...||.|||||::|.:                   ::|:  
Mouse   718 VTAYKDLPHAAQETFKRVLIREEEFDSIIVFYNSVFMQRL-------------------KTNI-- 761

  Fly   705 LTETTSNELSMRANISISSPPPPRVCQSGSCSSHPPSSP---AASPLSLQSSPNVKRAASSNDLM 766
                          :..:|..||.:    |...|.|.||   ::|||         |....|..:
Mouse   762 --------------LQYASTRPPTL----SPIPHIPRSPYKFSSSPL---------RIPGGNIYI 799

  Fly   767 REIKRP 772
            ..:|.|
Mouse   800 SPLKSP 805

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbf2NP_524372.1 DUF3452 83..210 CDD:288762 18/129 (14%)
RB_A 380..536 CDD:280101 43/177 (24%)
CYCLIN 564..679 CDD:294043 39/120 (33%)
Rb1NP_033055.2 DUF3452 109..219 CDD:288762 25/158 (16%)
Pocket, binds T and E1A. {ECO:0000250} 367..764 93/437 (21%)
Domain A. {ECO:0000250} 367..573 46/207 (22%)
RB_A 367..567 CDD:280101 45/201 (22%)
Spacer. {ECO:0000250} 574..632 5/58 (9%)
Domain B. {ECO:0000250} 633..764 42/170 (25%)
RB_B 639..756 CDD:280100 39/121 (32%)
Interaction with LIMD1. {ECO:0000250} 756..921 16/99 (16%)
Rb_C 761..917 CDD:286075 15/75 (20%)
Domain, mediates interaction with E4F1. {ECO:0000250} 764..921 15/56 (27%)
Nuclear localization signal. {ECO:0000250} 863..869
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C16887840
eggNOG 1 0.900 E1_KOG1010
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D113612at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_134617
Panther 1 1.100 O PTHR13742
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.