DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbf2 and lin-35

Sequence 1:NP_524372.1 Gene:Rbf2 FlyBaseID:FBgn0038390 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_491686.1 Gene:lin-35 WormBaseID:WBGene00003020 Length:961 Species:Caenorhabditis elegans

Alignment Length:925 Identity:174/926 (19%)
Similarity:341/926 (37%) Gaps:264/926 (29%)


  Fly     7 EGEAETLV---------RRFSVSCEQLELEARIQQSALSTYHRLDAVNGLSTSEADAQEWLCCAV 62
            |.:|::.:         :.|...|....|...|...|..||:.  ||..:|. |.....|...|:
 Worm   114 EDDADSFIDKTNTPPPSQSFLEGCRAANLPNDIVTGAWETYNH--AVQRVSL-EGSESAWQLSAI 175

  Fly    63 Y----SELQRSKMRDIRESINEANDSVAKNCCWNVSLTRLLRSFKMNVSQFLRRMEHWNWLTQNE 123
            |    |:..:.:.:.||..|..          :.||:..:..||.::|::.|.:...:..:..:.
 Worm   176 YYYLLSKGIKRRGKTIRILIQP----------FPVSILTIANSFDISVAEMLDKTARFVEIIHSR 230

  Fly   124 --NTFQLEVEELRCRLGITSTLLRHYKHIFRSLFVHPGKGADPGAANHYQALYEFGWLLFLVIRN 186
              ..:|..:..::..|.::..:.:.:..||..:|.....|::...::|  .|:...|..|||:::
 Worm   231 KIRRYQEYIRRIQEGLAVSCVIFKKFCRIFCKIFEEIKVGSENCPSSH--ELFTVLWTSFLVMKS 293

  Fly   187 ELPGFAITNLINGCQVL----------VCTM--------------DLL-----FVNAL--EVPRS 220
            .:   .:.:||:..|:|          :|:|              |||     .:.||  :...|
 Worm   294 RM---TVDDLISNYQLLFSILDQVYTEMCSMKEGIVHHLNQKFVEDLLENDCTIIRALCTQFGGS 355

  Fly   221 VVIRREFS----------GVPKNWDTEDFNPILLNKYSVLEALGELIPELPAKGVVQMKNAFFHK 275
            |:..|.||          |:|..|:.::|..:::|           :|:...:..:..:.:...:
 Worm   356 VLDARHFSDHTFKKMEKTGIPSTWNFQEFRDLIMN-----------VPKTAYENYLLQRGSIDER 409

  Fly   276 ALIMLYMDHSLV--GDDTH-MREIIK---EGMLDINLENLNRKYTNQVADISEMDERVLLSVQGA 334
            ..|....|.|.:  ..||: :.:|:|   .|....:.|.|.:...|...:...:..:|  :.:..
 Worm   410 IFIPSVEDFSKIFQSPDTYSVADILKVSYSGRRFRDAEFLTKISNNHCLEKLALGGKV--ASEKL 472

  Fly   335 IETKGDSPKSPQLAF--QTSSSPSHRKLSTHDLPASLPLSIIKAF----PKKED----------- 382
            :....:.|:.|.:.:  :..:.|...:.:...|...| ..||.::    .|.|:           
 Worm   473 VTQSKEQPRVPCVEYNLELGNYPDDLESNNQSLYNRL-TKIIGSWKLENSKLEEVCGTMSDSPMA 536

  Fly   383 -----ADKIVNYLDQTLE-EMNRTFTMAVKDF-----LDAELSGKRFRQARGLYYKYLQKILGPE 436
                 :|::.|..::||. |:..|....:..:     .:.||          ::..:::||:..|
 Worm   537 TILLKSDEMTNKFERTLSAELGETINENIPKYHYNVRKELEL----------VFLIFMEKIIVAE 591

  Fly   437 LVQKPQLK-IGQLMKQRKLTAALLACCLELALHVHHKLVEGL--RFPFVLHCFSLDAYDFQKILE 498
            |.:|.:.: :..::::.:...::...|:||.|     :..|.  .||:......:..:.|.|:::
 Worm   592 LKKKVREEDLLNVIRREEFLDSVFCFCVELIL-----VSNGYDRPFPWSAELCGVHPFMFHKVID 651

  Fly   499 LVVRYDHGFLGRELIKHLDVVEEMCLDSLIFRKSSQLWWELNQRLP--RYKEVDAETEDKEN--- 558
            |::.::.. |.|::::|...:||..::...::..|.| |.:..|.|  .::|...:..||.|   
 Worm   652 LMITHEKQ-LSRQMVQHFSRIEETVIEYFSWKSDSPL-WPMVVRCPFAHFQEFGEDWADKLNSYS 714

  Fly   559 --------------------------FSTGSSICLRKFYGLANRRLLLL---------CKSLCLV 588
                                      .|....|.|::.|..|.|||..|         .||.|  
 Worm   715 PIKFTPIKKPDDLRDELGRPIVPQNQTSRTLRIFLKRTYFTAARRLQDLTDRVSMGARAKSQC-- 777

  Fly   589 DSFPQIWHLAEHSFTLESSRLLRN-------RHLDQLLLCAIHLHVRLEKLHLTFSMIIQHYRRQ 646
                  |.|.::        ||||       |||||:|||.:.:.:::.:..:.|:.|:..||||
 Worm   778 ------WSLFDY--------LLRNDTLIFMDRHLDQILLCCVFVIMKINESSMLFTEIMAQYRRQ 828

  Fly   647 PHFRRSAYREVSLGNGQ---------------------------TADIITFYNSVYVQSMGNYGR 684
            .......||.|::...|                           |.|||.:||            
 Worm   829 SANSLLVYRSVTVFQEQLNPENPQAVNTKETILERLEGPQKEKTTVDIIKYYN------------ 881

  Fly   685 HLECAQTRKSLEESQSNVGILTETTSNELSMRANISISSPPPPRVCQSGSCSSHPPSSPAASPLS 749
             :|.....|.:      :|.:...:..:|......:.|...|.||.             ....||
 Worm   882 -IEFRDRIKYI------IGQIDSASDEDLMEMPVATESGLMPVRVY-------------LTHKLS 926

  Fly   750 LQSSPNVKRAASSND 764
            :|:.|..|...|..:
 Worm   927 IQTLPKTKHGESKQE 941

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbf2NP_524372.1 DUF3452 83..210 CDD:288762 26/153 (17%)
RB_A 380..536 CDD:280101 31/181 (17%)
CYCLIN 564..679 CDD:294043 41/158 (26%)
lin-35NP_491686.1 DUF3452 200..312 CDD:314758 22/117 (19%)
HIS2 <339..408 CDD:332175 13/80 (16%)
RB_A 507..690 CDD:307805 36/201 (18%)
RB_B 744..888 CDD:307804 42/173 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C16878224
eggNOG 1 0.900 E1_KOG1010
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I2796
Isobase 1 0.950 0 Normalized mean entropy S7132
OMA 1 1.010
OrthoDB 1 1.010 D113612at2759
OrthoFinder 1 1.000 FOG0002032
OrthoInspector 1 1.000 T374846
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13742
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1110.820

Return to query results.
Submit another query.