DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbf2 and rb1

Sequence 1:NP_524372.1 Gene:Rbf2 FlyBaseID:FBgn0038390 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_001269454.1 Gene:rb1 XenbaseID:XB-GENE-1018165 Length:900 Species:Xenopus tropicalis

Alignment Length:894 Identity:190/895 (21%)
Similarity:339/895 (38%) Gaps:231/895 (26%)


  Fly    17 FSVSCEQLELEARIQQSALSTYHRLDAVNGLSTSEADAQEWL--CCAVYSELQRSKMR-DIRESI 78
            |:|.||.|::...::..|..||.::.: :|....||..:..|  .|...:.:...:|. ...|.:
 Frog    30 FNVLCETLKISNNVRDKAWKTYEKIFS-SGYMMREATKKTELLGLCLYIASVDCEEMTFTFTELL 93

  Fly    79 NEANDSVAKNCCWNVSLTRLLRSFKMN-----------VSQFLRRMEHWNWLTQN-ENTFQLEVE 131
            .....||::  |:     ||||...:|           :|:..::.|....|.|. :.||::..|
 Frog    94 KTLTLSVSR--CF-----RLLREMDINMDVLSNKVDNAISKLKKKYETMCLLYQKFQRTFEIIFE 151

  Fly   132 ELRCRLGI--TSTLLRHYKHIFRSLFVHPGKGADPGAANHYQALYEFGWLLFLVIRNELPGFAIT 194
            |....|..  |:::|               ||.               |:.||:.|.::.... .
 Frog   152 EQHNTLASVDTASIL---------------KGT---------------WITFLLARGKILQMD-D 185

  Fly   195 NLINGCQVLVCTMDLLF---------------VNALEV---PRSVVIRREFSGVPKNWDTEDFNP 241
            :|:..||:|:|.:|...               :|||.|   |||  .||.     :|.:|.. :|
 Frog   186 DLVISCQLLLCVLDYFIKLSPPSVLKEPYKSALNALSVNTPPRS--SRRS-----QNRNTRS-SP 242

  Fly   242 ILLNKYSVLEALGELIPELPAK----GVVQMKNAFFHKALIMLYMDHSLVGDDTHMREIIKEGML 302
            .......|||.|        .|    .:.::||.:....:..|    :..|..:      .||..
 Frog   243 QSETDIKVLEIL--------CKENHCPMDEVKNVYCTSFVDFL----ASAGISS------SEGFP 289

  Fly   303 DINLENLNRKYTNQVADISEMDERVLL--------SVQGAIETKGDSPKS---------PQLAFQ 350
            .:  |:::::|........::|.|:.|        .||.:::.:....|.         ||..|:
 Frog   290 KV--ESISQQYEELYHKYKDLDARLFLENEETLKADVQDSLDLERTPRKDESEEVSIVPPQTPFR 352

  Fly   351 TSSSPSHRKLSTHDLPASLPLSIIKAFPKKEDADKIVNYLDQTLEEMNRTFTMAVKDF------- 408
            .:.:..|:...|.:..:..|            :||:.:|.:..........|..|:.|       
 Frog   353 AAMNTIHQLTVTLNSASDNP------------SDKLNSYFNNCTVNPKTKVTERVEHFGHVFKEK 405

  Fly   409 -------LDAELSGKRFRQARGLYYKYLQKILGPELVQKPQLKIGQLMKQRKLTAALLACCLELA 466
                   ..||:..||::....|||:.::.||..|..:.......:|:........||||.:|:.
 Frog   406 FASSVGQACAEIGYKRYKLGVRLYYRVMEAILKTEEERLSVHNFSKLLNNDIFHMCLLACAVEVV 470

  Fly   467 L--------HVHHKLVEGLRFPFVLHCFSLDAYDFQKILELVVRYDHGFLGRELIKHLDVVEEMC 523
            :        ..:......|.||::|..|.:.|:||.|::|..::.:.. |..::||:|:..|...
 Frog   471 IDSYTRNTAQAYFSSRTNLSFPWILRVFEIKAFDFYKVIECFIKAEPS-LTSDMIKYLERCEHQI 534

  Fly   524 LDSLIFRKSSQLWWELNQRLPRYKEVD-------------------------------------- 550
            ::||.::..|.|:..:.|...|...||                                      
 Frog   535 MESLAWQSDSPLFDLIRQTREREGLVDHPELVSTLQQPVQHNHTAADLYLSPSRSSHQCPVTSVR 599

  Fly   551 ---------AETEDKENFSTGSSICLRKFYGLANRRLLLLCKSLCLVDSFPQ----IWHLAEHSF 602
                     :.::..:..||..|:..:|.|.||.:||..||.|  |:...|:    ||.|.:|:.
 Frog   600 TSSVTNGQVSPSQPVQQKSTSLSLFYKKVYLLAYKRLSSLCSS--LLSDHPELEQVIWTLLQHTL 662

  Fly   603 TLESSRLLRNRHLDQLLLCAIHLHVRLEKLHLTFSMIIQHYRRQPHFRRSAYREVSLGNGQTADI 667
            ..| ..|:|:|||||:::|:::...:.:.:.|.|..|:..|:...:..:..::.|.:.:||...|
 Frog   663 QHE-YELMRDRHLDQIMMCSMYGICKAKNIDLRFKTIVTAYKGLTNTNQETFKHVLIRDGQHDSI 726

  Fly   668 ITFYNSVYVQSMGN----YG--RHLECAQTRKSLEESQSNVGILTETTSNELSMRANISISSPPP 726
            |.|||.|::|.:.:    ||  ||...:.. ..:..|....|       |...:..||.:|....
 Frog   727 IVFYNLVFMQKLKSHILQYGSARHPTLSPI-PHIPRSPYRFG-------NSPKVPGNIYVSPLKT 783

  Fly   727 PRVCQSGSCSSHPPSSPAASPLSLQS---SPNVKRAASSNDLMREIKRP 772
            |.....|..|....:...:..:||..   ||:  |....|.::...:||
 Frog   784 PYKTTDGLLSPSKMTPKTSFLISLGETFRSPD--RFQKINQMLNSCERP 830

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbf2NP_524372.1 DUF3452 83..210 CDD:288762 31/141 (22%)
RB_A 380..536 CDD:280101 41/178 (23%)
CYCLIN 564..679 CDD:294043 39/119 (33%)
rb1NP_001269454.1 DUF3452 99..200 CDD:288762 31/139 (22%)
RB_A 349..550 CDD:280101 45/214 (21%)
RB_B 620..737 CDD:280100 39/120 (33%)
Rb_C 742..896 CDD:286075 21/100 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D113612at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.