DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5516 and Zcchc10

DIOPT Version :9

Sequence 1:NP_001189228.1 Gene:CG5516 / 41940 FlyBaseID:FBgn0038389 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001257955.1 Gene:Zcchc10 / 360524 RGDID:1308149 Length:169 Species:Rattus norvegicus


Alignment Length:176 Identity:71/176 - (40%)
Similarity:99/176 - (56%) Gaps:30/176 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RKLAQKKRSAKQAADFPNGIRCQKCLQIGHWSYECKEKRKYVHRSSRTKQLSKRMSQKEADAPKN 73
            |.:|:::..|.:     ..:||||||:.|||:||||.||||:||.|||.:|.|.:.:||     |
  Rat     3 RLIARRQAEANK-----QHVRCQKCLEFGHWTYECKGKRKYLHRPSRTAELKKALKEKE-----N 57

  Fly    74 QVEEHSEVASSEGKKVRRKRKTSKSSSSSSSSSDSSDSSSE-----SGSSSESD----------- 122
            ::.:.|...::..:|.::||:....:|:|||.|.:|:||||     |.||.:||           
  Rat    58 RLLQQSMGETNTERKTKKKRRPKSVTSTSSSDSSASESSSESETSASSSSEDSDADGSLSSSSSS 122

  Fly   123 ----SSSSSSDSDDEEGSSSDSSGSGSDSDSSEDQKQGAPQKKKKR 164
                ||||||.|.....|.||||.|.|.|.|||......|.||:|:
  Rat   123 SAYSSSSSSSSSSSSSSSDSDSSSSSSSSSSSESSSDDEPPKKRKK 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5516NP_001189228.1 zf-CCHC_3 27..59 CDD:290628 22/31 (71%)
Zcchc10NP_001257955.1 zf-CCHC_3 13..52 CDD:290628 24/43 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10206
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4632
OMA 1 1.010 - - QHG54889
OrthoDB 1 1.010 - - D1638633at2759
OrthoFinder 1 1.000 - - FOG0006615
OrthoInspector 1 1.000 - - otm46394
orthoMCL 1 0.900 - - OOG6_104907
Panther 1 1.100 - - LDO PTHR13491
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5618
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.070

Return to query results.
Submit another query.