DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pbp45 and snapc1

DIOPT Version :8

Sequence 1:NP_650499.1 Gene:Pbp45 / 41920 FlyBaseID:FBgn0038371 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001072646.1 Gene:snapc1 / 780103 XenbaseID:XB-GENE-993180 Length:364 Species:Xenopus tropicalis

Alignment Length:353 Identity:68/354 (19%)
Similarity:127/354 (36%) Gaps:96/354 (27%)


  Fly     8 DCWELVQRFQRLVNDGENCEFEVFCRCWRELQLQHLFTAQTNHTEVIATTLAALHVAKRLSCSRR 72
            ||..::.|||    :.::..||.|...|::::..|::.....:.|:......||.||......  
 Frog     9 DCETILGRFQ----ETDSVRFEEFAAIWKDMKFSHIYFGGMRNLEMSKFAREALSVASHYFLP-- 67

  Fly    73 TTGDVFPASRAQRIGGFFLLYVIYYKQPTHNFIKIEVSPRTWQELTDYALDLRKDSPERKDTHQI 137
                  |.:...|:|..:|||.:|..|......||.|:.:.|.::..:..||  ...:..|.   
 Frog    68 ------PYTFQIRVGALYLLYGLYNSQLCQPKQKIRVALKDWDDIEKFYQDL--IGAQHLDA--- 121

  Fly   138 AYMLWRLTQEQAFRFTALDYCQGLDNLVDYDRVETVAGAKEQRQSALMQKQQRANGVSLTYELEG 202
            ||::.:|...:||.||      |:...:.:         :.||      .|.|..|      .|.
 Frog   122 AYIMRQLRLSRAFHFT------GMAEFLTF---------RSQR------NQPRHVG------REE 159

  Fly   203 LRALDQASQPLCELEAAYNAQKKQLAAGHEHALPPSQIFGHLREVFADIQSVLGARKSTPDENCT 267
            .:.:....|.|...|..     :::...|||              :...:.::.|.||.||.:.:
 Frog   160 FKDVRDRVQDLVTSETL-----EEMLNIHEH--------------YQKTKCLISADKSQPDRSLS 205

  Fly   268 TTSTGNQLEVRQRVRNKAMYGVEEREPQNQADELEVQLEVNETYQRRMSSATVFQRELPADVQQE 332
            .........::|.:.....:.:|:.:|:.:.|:   :.|.||                       
 Frog   206 LVKEDYVPNLKQLLSEHVTWKLEKGKPRTKNDD---EKEENE----------------------- 244

  Fly   333 YEMIEFSDDEEMEVGESEEVTEEELKAI 360
                   :::|....|||:.:.|..|.:
 Frog   245 -------EEKEATSQESEKESSERAKTL 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pbp45NP_650499.1 SNAPc_SNAP43 5..214 CDD:286846 46/206 (22%)
snapc1NP_001072646.1 SNAPc_SNAP43 6..190 CDD:313098 50/244 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C263114396
eggNOG 1 0.900 E1_KOG4746
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1269640at2759
OrthoFinder 1 1.000 FOG0002771
OrthoInspector 1 1.000 T1060063
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3936
TreeFam 1 0.960
76.830

Return to query results.
Submit another query.