DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pbp45 and Snapc1

DIOPT Version :8

Sequence 1:NP_650499.1 Gene:Pbp45 / 41920 FlyBaseID:FBgn0038371 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_848479.1 Gene:Snapc1 / 75627 MGIID:1922877 Length:389 Species:Mus musculus

Alignment Length:351 Identity:69/351 - (19%)
Similarity:129/351 - (36%) Gaps:80/351 - (22%)


  Fly    12 LVQRFQRLVNDGENCEFEVFCRCWRELQLQHLFTAQTNHTEVIATTLAALHVAKRLSCSRRTTGD 76
            |:.|||.:    ::..||.|...||.::...:|..:..:.:....|..||.:|.|.         
Mouse    33 LLSRFQEM----DSVRFEDFTELWRSMKFATIFCGKMRNLKKNMFTKEALALAWRY--------- 84

  Fly    77 VFPASRAQ-RIGGFFLLYVIYYKQPTHNFIKIEVSPRTWQELTDYALDLRKDSPERKDTHQIAYM 140
            ..|....| |:|..:|||.:|..|......||.|:.:.|.|:..:..||.  :.:..|.   |::
Mouse    85 FLPPHTFQIRVGALYLLYGLYNTQLCQPKQKIRVALKDWDEVIRFQQDLM--NAQHFDA---AFV 144

  Fly   141 LWRLTQEQAFRFTALDYCQGLDNLVDYDRVETVAGAKEQRQSALMQKQQRANGVSLTYELEGLRA 205
            ..:|..::||.|||:            .::.:....|:.:|:.:.||.:..|             
Mouse   145 FRKLRLDRAFHFTAM------------PKLLSCRMKKKVQQTEVTQKFKDPN------------- 184

  Fly   206 LDQASQPLCE--LEAAYNAQKKQLAAGHEHALPPSQIFGHLREVFADIQSVLGARKSTPDENCTT 268
             |:..:.:..  ||...|.        |:|              :.:::..:.|.||.||...:.
Mouse   185 -DRVMKLITSDVLEEMLNV--------HDH--------------YQNMKHAISADKSMPDRALSL 226

  Fly   269 TSTGNQLEVRQRVRNKAMYGVEEREP------QNQADELEVQLEVNETYQRRMSSATV----FQR 323
            ........::..|.....:..|.:.|      ::..:..|...|..|..:|.:|.|.:    |..
Mouse   227 VKEDFFENIKNIVLEHQEWHKERKNPSLKPKLKDGEENGEGSSEEPERCERAVSLAKIKAKAFSA 291

  Fly   324 ELPADVQQEYEMIEF-SDDEEMEVGE 348
            .:|....:.:...:. |.|.:...|:
Mouse   292 VVPVSKSRRHRQSKLDSSDSDSGSGQ 317

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pbp45NP_650499.1 SNAPc_SNAP43 5..214 CDD:286846 45/202 (22%)
Snapc1NP_848479.1 SNAPC3-binding. {ECO:0000250} 20..187 45/197 (23%)
SNAPc_SNAP43 26..210 CDD:286846 50/242 (21%)
SNAPC4-binding. {ECO:0000250} 183..287 21/139 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C263108928
eggNOG 1 0.900 E1_KOG4746
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002771
OrthoInspector 1 1.000 T1084090
orthoMCL 1 0.900 OOG5_134436
Panther 1 1.100 LDO PTHR15131
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3936
TreeFam 1 0.960
87.820

Return to query results.
Submit another query.