DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pbp45 and snpc-1.1

DIOPT Version :8

Sequence 1:NP_650499.1 Gene:Pbp45 / 41920 FlyBaseID:FBgn0038371 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_495636.2 Gene:snpc-1.1 / 174255 WormBaseID:WBGene00015513 Length:473 Species:Caenorhabditis elegans

Alignment Length:378 Identity:84/379 (22%)
Similarity:136/379 (36%) Gaps:107/379 (28%)


  Fly    18 RLVNDGENCEFEVFCRCWRELQLQHLFTAQTNHTEVIATT-----LAALHVAKRLSCSRRTTGDV 77
            :.::.|.| ....|...:|::..:.:...:.|..|.:..|     .||::..|        ..:|
 Worm    25 KFISMGSN-RIRDFADVFRDMHFETILHYRLNPAECLEFTEYLLQHAAMYFGK--------VNEV 80

  Fly    78 FPASRA--QRIGGFFLLYVIYYKQPTHNFIKIEVSPRTWQELTDYALDLRKDSPERKDTHQIAYM 140
             .|.||  :|:.|.::.|.:|..||..:..:|.|:...::||    |:.:|.....|....|| .
 Worm    81 -GAFRAFKERLFGVYVCYALYNLQPVDHVCQIPVTAVQFEEL----LEFQKSLEVEKLLEPIA-A 139

  Fly   141 LWRLTQEQAFRF----------TALDYCQGLDNLVDYDR--VETVAGAKEQRQSALMQKQQRANG 193
            |..|..::|||.          |...|. ..:.|..:::  ||..:...:...|.:|.:....:|
 Worm   140 LKMLILKKAFRIKVFQSTYDPATHKKYL-AEEELPYFNKIPVEPFSSVTKMLSSDIMTELSFIHG 203

  Fly   194 V--------SLTYELEGLRALDQASQPLCELEAAYNAQKKQL----------------------- 227
            |        .|:..|.||::      ||.|::......|:|.                       
 Worm   204 VYTEAKQKLGLSDTLTGLKS------PLHEIKGIVEKYKEQFESSPTNPEISSAPEETAGSSRST 262

  Fly   228 ------AAGHEHA-----LPPS--QIFGHL-REVFADI-QSVLGARKSTPDENCTTTSTGNQLEV 277
                  |.|.:|.     |.|:  :.|.|| ...|.|| |..|       |:|...........|
 Worm   263 LRSKAYAEGLKHTRQRRHLDPNMEENFKHLTARTFGDIAQECL-------DDNDAQVPIPIDRPV 320

  Fly   278 RQRVRNKAMYGVEEREPQNQADELEVQLEV--NETYQRRMSSATVFQRELPAD 328
            |||.|.|    .....|:...|:..:..||  || |..|:      :.|:|.|
 Worm   321 RQRRRRK----TTTVNPEELLDDNALAEEVLRNE-YAARI------KPEIPED 362

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pbp45NP_650499.1 SNAPc_SNAP43 5..214 CDD:286846 49/223 (22%)
snpc-1.1NP_495636.2 SNAPc_SNAP43 15..209 CDD:286846 43/200 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C260465343
eggNOG 1 0.900 E1_KOG4746
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002771
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_134436
Panther 1 1.100 LDO PTHR15131
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3936
TreeFam 1 0.960
76.820

Return to query results.
Submit another query.