DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Man-IIb and man2a1

DIOPT Version :8

Sequence 1:NP_001262614.1 Gene:alpha-Man-IIb / 41913 FlyBaseID:FBgn0026616 Length:1249 Species:Drosophila melanogaster
Sequence 2:NP_001103497.2 Gene:man2a1 / 560219 ZFINID:ZDB-GENE-060526-31 Length:1150 Species:Danio rerio

Alignment Length:1144 Identity:394/1145 (34%)
Similarity:593/1145 (52%) Gaps:190/1145 (17%)


  Fly   148 WDRGFEERFDAQKKDKQRPPLKIIVVPHSHNDPGWLKTFTNYFQSDSRQILNLLVTKMQEYTDMT 212
            |.:||:..:...:.|.:  ||::.|||||||||||||||.:|::..::.|||.:|.|:.|.:...
Zfish   146 WKQGFDISYQENEWDNE--PLQVFVVPHSHNDPGWLKTFDDYYRDQTQHILNNMVVKLHEDSRRK 208

  Fly   213 FIWSEISFLQLWWDQAHPTKQRALKRLIDAGRIEITTGGWVMTDEANVHIYPMLDQLIEGHQWLK 277
            .||||||:...|||.....||.|::||::.|::|:.||||||.||||.|.:.|:|||:||||||:
Zfish   209 MIWSEISYFAKWWDSIDGQKQDAVRRLVENGQLEVATGGWVMPDEANAHYFAMIDQLVEGHQWLE 273

  Fly   278 NNLNVTPKVGWSIDPFGHGSTVPYLLSGANFEGTIIQRIHYAWKQWFARQQSGDFIWKPYWRSRK 342
            .||.|.||.||::|||||.:|..|||..|.....:|||:||:.|:.|:.|::.:|.|:..|    
Zfish   274 RNLGVKPKTGWAVDPFGHTATQAYLLKLAGLSNMLIQRVHYSVKKHFSSQKTLEFFWRQNW---- 334

  Fly   343 DKDSEAGSLLTHNMPFDIYSIKGSCGPHPFICLNFDFRKIPGEYTE--YSVKAQFITDDNLESKA 405
            |:||.. .:|.|.|||..|.:..:|||.|.||..|||:::||....  :.:..|.|||:|::.:|
Zfish   335 DQDSST-DILCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGGRISCPWRIPPQAITDNNVQERA 398

  Fly   406 QLLLEQYARTASLFPHNVALIPVGDDFRYNKDREVDQQYQNYKKLIDHIMANRRLYNADIRFGTP 470
            |.||:||.:.:.||...|.|.|:||||||.:..|.|||::||:||.|::.::..|: ...:|||.
Zfish   399 QTLLDQYRKKSKLFRTKVLLAPLGDDFRYTEAVEWDQQFENYQKLFDYMNSHPELH-VKAQFGTI 462

  Fly   471 SDYFEAIKERMKDHTPG-------FPTFKGDFFVYSDIFSEGRPAYWSGYFTTRPFYKLLSSELE 528
            ||||:|:::.......|       .|...||||.|:|....    |||||||:|||||.:...||
Zfish   463 SDYFQALRKSTGMDPVGMNVGHLALPVVSGDFFTYADRDDH----YWSGYFTSRPFYKRMDRMLE 523

  Fly   529 HQLRSAEIVFTLAYNTARQAKRENAIKIYEKNYELIINARRNLGLFQHHDAITGTSKAAVMRDYA 593
            ..||:||::::|.....::..:.:.....| ||:|:..||||||||||||||.||.|..|:.||.
Zfish   524 SYLRAAEVLYSLTLANIQKYGQPSDYPAGE-NYKLLTEARRNLGLFQHHDAIAGTGKDWVVVDYG 587

  Fly   594 MRLFESTQNMVKMQESCLELLLQKGQPRHH-----GFLLSEFERDNFNKLPRKMPIQMANGDEST 653
            .|||.|..|:.::..|....|:.|.:..:|     .||..:..:.:.:.||||..:::       
Zfish   588 TRLFHSILNVKRVIVSSAHWLVLKDKQTYHNDPSKAFLQMDDVQQSQDALPRKNVLEV------- 645

  Fly   654 PTVPAGEGGAGGSSSSGSVGSFVLYNSLAQKRLEVVTLRVQHPNVKIVNDKGVELNHIQINPVWN 718
                           .|.....|:.|.|.|.|..:||:.|..|||::|:..| ::...|::.||.
Zfish   646 ---------------HGKPRLLVVSNPLEQARTSMVTVYVNTPNVRVVSALG-QVVRAQVSAVWK 694

  Fly   719 ITDTYEQGLGTSVSGTVGRIRTSTRQFEVMFVAELEPLSLSTYRVQVDEVNFKRNIATIYCDDCT 783
            ...                 ..:...|::.|||...||.||.|  |:.||...|..|:.|. ...
Zfish   695 DAS-----------------HATADVFQLSFVAHAAPLGLSVY--QLIEVMEPRTDASKYM-FLQ 739

  Fly   784 ESQPASVSPPEEIESSPTSVFEARGKPAGDIQLENPHMRLLFDEKSGFLKTITRKNQKKELLKPL 848
            |.:..|.|..|...    ..::..|.|   :.:||||:||.....:|.|:.:..|..:.|    .
Zfish   740 EGRQLSDSKLEHFR----QFYQDDGAP---VVIENPHLRLSISGATGLLEKMMLKEDESE----H 793

  Fly   849 QCNIKFAAY--RSAQFHSGAYLFKTDPE---QSEAEKEVLEGYTDMRIIITSGPIASDVTVIYGP 908
            |..::|..|  .|::..||||||..|.|   .|.::..|:.        :|.|.:.|:||..:. 
Zfish   794 QMKVEFVWYGTTSSKDKSGAYLFLPDKEATIYSPSQPPVIR--------VTKGTLFSEVTTTFA- 849

  Fly   909 FLAHTVRIFNTRTHLDAAIYVENDIDFEPPPKNRETELFMRFVTNIDNIAQAPMQRDPLKEPVDA 973
            .:.||:|::||:.....::.:.|.:|.. ...||  |:.||..:::::       :|.       
Zfish   850 HITHTLRLYNTQGVEGQSVEICNTVDIR-GETNR--EIAMRITSDLNS-------KDR------- 897

  Fly   974 ATMPELPVFYSDQNGFQYHERIKVPAIGIEGNYFPITSGAFIQDSRLRLTLLTTHAQGAASYEPG 1038
                    |::|.||:|...|..:..:.::.|::|:||..::|||..||:|||..:.||||.:.|
Zfish   898 --------FFTDLNGYQVQPRKTMAKLPLQANFYPMTSMLYLQDSSARLSLLTAQSLGAASLKSG 954

  Fly  1039 QLEVMLDRRTLYDDYRGMGEGVVDSRLTRHKFWLLVEDLPGGQHVTQPPSYKVLSQQAQQLANAL 1103
            ||||::|||...||.||:|:||:|:::|.:.|.||:|              |.:|.:..:.....
Zfish   955 QLEVIMDRRLNQDDNRGLGQGVLDNKITANSFRLLLE--------------KRISVEENEATAPY 1005

  Fly  1104 RYPPNLYFVS--NLEQPELAAAL---LPLVRLLPKGPL----PCDVHLTTLRTLSDPELQLFPSA 1159
            .||..|..:|  .|..|.::.|:   |....::|..||    |||:||..||.:...|.....|.
Zfish  1006 SYPSILSHMSYMYLNHPLISMAVSQHLEAPSVVPYSPLKASFPCDMHLVNLRAIQSKEEGGAASE 1070

  Fly  1160 SALLVLHRQGFDCSVS-----------AGR--------ELSMEAICPLSSKGLGNVQLGRLSL-H 1204
            .|.|:|||:||||..|           .|:        :|.:::|.|:|           ||| |
Zfish  1071 QAALILHRKGFDCGFSNRNTGLLCTSTRGKIDLEKLLTDLKVKSITPVS-----------LSLMH 1124

  Fly  1205 TIEATSLTGTEQKSSRESYHIRSLAEISLEPMELRTFNL 1243
            |:.:.|..                .||||:.||:||:.|
Zfish  1125 TLSSESRP----------------QEISLKAMEIRTYRL 1147

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-Man-IIbNP_001262614.1 PLN02701 148..1246 CDD:178304 394/1145 (34%)
GH38N_AMII_GMII_SfManIII_like 167..514 CDD:212120 162/356 (46%)
Alpha-mann_mid 508..596 CDD:286360 44/88 (50%)
Glyco_hydro_38C 813..1241 CDD:285047 136/462 (29%)
man2a1NP_001103497.2 PLN02701 127..1149 CDD:178304 394/1145 (34%)
GH38N_Man2A1 163..509 CDD:212131 162/356 (46%)
Alpha-mann_mid 504..590 CDD:214875 44/87 (51%)
Glyco_hydro_38C 763..1145 CDD:285047 136/461 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1101882at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.