DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Man-IIb and man2b1

DIOPT Version :8

Sequence 1:NP_001262614.1 Gene:alpha-Man-IIb / 41913 FlyBaseID:FBgn0026616 Length:1249 Species:Drosophila melanogaster
Sequence 2:XP_005169420.1 Gene:man2b1 / 541519 ZFINID:ZDB-GENE-050327-52 Length:984 Species:Danio rerio

Alignment Length:1149 Identity:287/1150 (25%)
Similarity:462/1150 (40%) Gaps:280/1150 (24%)


  Fly   168 LKIIVVPHSHNDPGWLKTFTNYFQSDS--------RQILNLLVTKMQEYTDMTFIWSEISFLQLW 224
            |.:.:|||:|:|.|||||...||..|.        :.||:.::.::|:.....||:.|.:|...|
Zfish    44 LNVHLVPHTHDDVGWLKTVDQYFYGDRNNIQHAGVQYILDSVIDQLQKDPARRFIYVETAFFYRW 108

  Fly   225 WDQAHPTKQRALKRLIDAGRIEITTGGWVMTDEANVHIYPMLDQLIEGHQWLKNNLNV--TPKVG 287
            |.|.:...:|.:.:|::.||:|...|||.|:|||..|...::||:..|.::|.:....  .|:|.
Zfish   109 WRQQNQNTRRIVTQLVNEGRLEFINGGWCMSDEATTHYSAVIDQMTLGLRFLNDTFGECGRPRVA 173

  Fly   288 WSIDPFGHGSTVPYLLSGANFEGTIIQRIHYAWKQWFARQQSGDFIWKPYWRSRKDKDSEAGSLL 352
            |.||||||......:.:...::|....|:.|..|....:.:..:.:    ||:.:........|.
Zfish   174 WHIDPFGHAREHASIFAQMGYDGFFFGRLDYQDKDRRMKTKEMEML----WRASESLTPPIADLF 234

  Fly   353 THNMPFDIYSIKGSCGPHPFICLNFDFRKIPGEYTEYSVKAQFITDDNLESKAQLLLEQYARTAS 417
            |..:|......:|.|....  |.:...|..|.           :.|.|::...|..|....:.|.
Zfish   235 TGVLPNGYNPPEGFCWDQS--CDDAPIRDDPD-----------LEDYNVDEIVQKFLNASHKQAD 286

  Fly   418 LFPHNVALIPVGDDFRYNKDREVDQQYQNYKKLIDHIMA-NRRLYNADIRFGTPSDYFEAIKERM 481
            .:..|..::.:|.||:|   ...:..|:|..|||.::.| ..:....::.:.|||.|.:.:  .:
Zfish   287 YYKTNHIIMTMGSDFQY---ENANLWYKNMDKLIKYVNALQAKGSKLNVLYSTPSCYLQEL--NL 346

  Fly   482 KDHTPGFPTFKGDFFVYSDIFSEGRPAYWSGYFTTRPFYKLLSSELEHQLRSAEIVFTLAYNTAR 546
            .:.|  :|....|||.|:|...:    :|:||||:||..||.......:|::...:..|...|:.
Zfish   347 ANFT--WPMKTDDFFPYADDAHD----FWTGYFTSRPALKLYERLSNSRLQTCNQLEVLGGPTST 405

  Fly   547 QAKRENAIKIYEKNYELIINARRNLGLFQHHDAITGTSKAAVMRDYAMRLFESTQNMVKMQESCL 611
            ..      ...|.:.:.:   ||.:|:.|||||::||.|..|..|||.||.....:...:..:.|
Zfish   406 SG------PFGEGDSDTM---RRAMGVAQHHDAVSGTEKQHVANDYARRLATGWAHCEVLVSNSL 461

  Fly   612 ELLLQKGQPRHHGFLLSEFERDNFNKLPRKMPIQMANGDESTPTVPAGEGGAGGSSSSGSVGSFV 676
            .:|.....||..      .|..|.:..|                          .:.|....|..
Zfish   462 AVLSGSEAPRVF------CENLNISVCP--------------------------LTESSHKFSMN 494

  Fly   677 LYNSLAQKRLEVVTLR--VQHPNVKIVNDKGVELNHIQINPVWNITDTYEQGLGTSVSGTVGRIR 739
            :||.|.:      |:|  |:.|    ||           ..|:|:||...:.:.:.|. .:.:.|
Zfish   495 VYNPLGR------TVRWPVRLP----VN-----------GSVYNVTDANGKAVDSEVI-PLSKSR 537

  Fly   740 TSTRQ------FEVMFVAELEPLSLSTYRVQVDEVNFKRNIATIYCDDCTESQPASVSPPEEIES 798
            ...||      .|::|..|..||..|||.:.:                 .:.||           
Zfish   538 KEVRQNRGFAKSELVFQVEAPPLGYSTYIISM-----------------VQDQP----------- 574

  Fly   799 SPTSVFEARGKPAGDIQLENPHMRLLFDEKSGFLKTITRKNQKKELLKPLQCNIKFAAYRSA--- 860
             |.|    |.|.|....::|..:::.||..:|.|.::|    ..|..:.::....|..|.::   
Zfish   575 -PVS----RSKNAVPSSIQNKFLKVTFDSTTGLLSSLT----NLETQQTIRLTQNFFWYNASAGN 630

  Fly   861 --QFH--SGAYLFKTDPEQSE-------AEKEVLEGYTDMRIIITSGPIASDVTVIYGPFLAHTV 914
              :.|  ||||:|:  |..|:       ||.:.:..|..::          :||..:.|:::..|
Zfish   631 NKESHQPSGAYIFR--PNSSDPFIISKTAEIQAVSLYNSVQ----------EVTQRFSPWVSQVV 683

  Fly   915 RIFNTRTHLDAAIYVENDIDFEPPPKNRETELFMRFVTNIDNIAQAPMQRDPLKEPVDAATMPEL 979
            |::..|..|        ::::...|...|..|....:|.:|...|:.                  
Zfish   684 RLYEDRREL--------ELEWTVGPVPVEDGLGKEVITRLDTDIQSS------------------ 722

  Fly   980 PVFYSDQNGFQYHERIK-----------VPAIGIEGNYFPITSGAFIQDSRLRLTLLTTHAQGAA 1033
            ..||:|.||.:..||.|           .|   |.|||:||.|.|:|:|.:.:||::|..:|||:
Zfish   723 GYFYTDSNGREVLERRKDYRPTWDLKQTEP---IAGNYYPINSRAYIKDDKRQLTVVTDRSQGAS 784

  Fly  1034 SYEPGQLEVMLDRRTLYDDYRGMGEGVVD------SRLTRHKFWLLVEDLPGGQHVTQPPSYKVL 1092
            |...|.||:||.||.||||:||:||.:.:      ..:.|.:..|.:          .||  :..
Zfish   785 SIYNGSLEIMLHRRLLYDDFRGVGEPLSEPGEFAHGLVARGRLLLTL----------SPP--EAA 837

  Fly  1093 SQQAQQLANALRYPPNLYFV-------SNLEQPELAAALLPLVRLLPKGPLPCDVHLTTL----- 1145
            :...:.||.::...|.|.|.       :.||...|.|||.|.|.||.......|..|..|     
Zfish   838 ADLHRPLAQSMVLQPLLSFQDGAPSPGTKLEFSGLQAALPPAVHLLTVSQWDQDSVLVRLEHQYQ 902

  Fly  1146 ----RTLSDP---ELQ-LFPSASALLVLHRQGFDCSVSAGRELSMEAICPLSSKGLGNVQLGRLS 1202
                :|.|.|   .|| ||   |.|.||          ...|:|:         |....:...:.
Zfish   903 AKESKTHSQPVTVNLQKLF---STLQVL----------GASEMSL---------GANQWKEDMIR 945

  Fly  1203 LHTIEATSLTGTEQKSSRESYHIRSLAEISLEPMELRTFNLTFR 1246
            ||       ..||:.:...:....|..|::|:|||:|||.|..|
Zfish   946 LH-------WNTEKDALPPTARDPSSWEVTLKPMEIRTFLLRVR 982

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-Man-IIbNP_001262614.1 PLN02701 148..1246 CDD:178304 286/1148 (25%)
GH38N_AMII_GMII_SfManIII_like 167..514 CDD:212120 94/357 (26%)
Alpha-mann_mid 508..596 CDD:286360 29/88 (33%)
Glyco_hydro_38C 813..1241 CDD:285047 122/479 (25%)
man2b1XP_005169420.1 PLN02701 44..982 CDD:178304 286/1148 (25%)
GH38N_AMII_LAM_like 44..322 CDD:212121 79/298 (27%)
Alpha-mann_mid 368..446 CDD:214875 29/87 (33%)
Glyco_hydro_38C 558..977 CDD:285047 134/538 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001898
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.