DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Man-IIb and LManII

DIOPT Version :8

Sequence 1:NP_001262614.1 Gene:alpha-Man-IIb / 41913 FlyBaseID:FBgn0026616 Length:1249 Species:Drosophila melanogaster
Sequence 2:NP_609408.1 Gene:LManII / 34437 FlyBaseID:FBgn0027611 Length:1080 Species:Drosophila melanogaster

Alignment Length:1220 Identity:290/1221 (24%)
Similarity:468/1221 (38%) Gaps:339/1221 (28%)


  Fly   168 LKIIVVPHSHNDPGWLKTFTNYF--------QSDSRQILNLLVTKMQEYTDMTFIWSEISFLQLW 224
            |.:.:|.|:|:|.|||||...|:        ::..:.|::.:|..:....:..||:.|.:|...|
  Fly    47 LNVHLVAHTHDDVGWLKTVDQYYYGSETKIQKAGVQYIIDSVVEALLRDPEKRFIYVESAFFFKW 111

  Fly   225 WDQAHPTKQRALKRLIDAGRIEITTGGWVMTDEANVHIYPMLDQLIEGHQWLKNNLNVT------ 283
            |.:..|..|.|:|.|::.||:|...|.|.|.|||..|...::||.    .|....||.|      
  Fly   112 WKEQKPKVQEAVKMLVEQGRLEFIGGAWSMNDEATTHYQSVIDQF----SWGLRLLNDTFGECGR 172

  Fly   284 PKVGWSIDPFGHGSTVPYLLSGANFEGTIIQRIHYAWKQWFARQQSGDFIWKPYWRSRKDKDSEA 348
            |:|||.||||||...:..:.:...|:|....|:.|..|......::.:.||.......::.|..:
  Fly   173 PRVGWQIDPFGHSREMASMFAQMGFDGMFFGRLDYQDKDERLMTKNAEMIWHGSANLGEEADLFS 237

  Fly   349 GSLLTHNMPFDIYSIKGSCGPHPFICLNFDFRKIPGEYTEYSVKAQFITDDNLESKAQLLLEQYA 413
            |:|..:....|.:.....|...|.|    |.:..|              |:|::.:....|: :|
  Fly   238 GALYNNYQAPDGFCFDILCNDAPII----DGKHSP--------------DNNVKERIDTFLD-FA 283

  Fly   414 RTAS-LFPHNVALIPVGDDFRYNKDREVDQQYQNYKKLIDHIMANRRLYNA---DIRFGTPSDYF 474
            :|.| .:..|..::.:|.||.|   :.....|:|..|||.:  .|.|..|.   ::.:.|||.|.
  Fly   284 KTQSQYYRTNNIIVTMGGDFTY---QAAQVYYKNLDKLIRY--GNERQANGSNINLLYSTPSCYL 343

  Fly   475 EAIKERMKDHTPG--FPTFKGDFFVYSDIFSEGRPAYWSGYFTTRPFYKLLSSELEHQLRSAEIV 537
            :::      |..|  :||...|||.|    :....|||:||||:||..|....:..|.|:..:.:
  Fly   344 KSL------HDAGITWPTKSDDFFPY----ASDPHAYWTGYFTSRPTLKRFERDGNHFLQVCKQL 398

  Fly   538 FTLAYNTARQAKRENAIKIYEKNYELIINARRNLGLFQHHDAITGTSKAAVMRDYAMRLF----- 597
            ..||.....:         ::.:...:   |..||:.|||||||||.|..|..|||.|:.     
  Fly   399 SALAPKKPEE---------FDPHLTFM---RETLGIMQHHDAITGTEKEKVALDYAKRMSVAFRA 451

  Fly   598 --ESTQNMVKMQESCLELLLQKGQPRHHGFLLSEFERDNFNKLPRKMPIQMAN----GDESTPTV 656
              .:|:|.:.      :|.:|              .:||......|...:...    ...|.|..
  Fly   452 CGATTRNALN------QLTVQ--------------SKDNVKDTSAKYVFEFKTCALLNITSCPVS 496

  Fly   657 PAGEGGAGGSSSSGSVGSFVLYNSLAQKRLEVVTLRVQHPNVKIVNDKGVELNHIQINPVWNITD 721
            .|.:..|           ..|||.||....|.|.:.|.:.|.:|:::|||.|.. |..|:..:..
  Fly   497 EANDRFA-----------LTLYNPLAHTVNEYVRIPVPYSNYRIIDNKGVTLES-QAVPIPQVLI 549

  Fly   722 TYEQGLGTSVSGTVGRIRTSTRQFEVMFVA-ELEPLSLSTYRVQVDEVNFKRNIATIYCDDCTES 785
            ..:.             |.||.::|::|:| .:..|...||.|:.              .|.||.
  Fly   550 DIKH-------------RNSTAKYEIVFLATNIPALGYRTYYVEK--------------LDSTEG 587

  Fly   786 QPASVSPPEEIESSPTSVFEARGKPAGDIQLENPHMRLLFDEKSGFLKTITRKNQKKELLKPLQC 850
            ...|.:.|:...|...              :.|.|::|.|| .:|||..:|...    |.:.:..
  Fly   588 NTRSKALPKRTSSVTV--------------IGNSHIQLGFD-TNGFLSEVTADG----LTRLVSQ 633

  Fly   851 NIKF---AAYRSAQF---HSGAYLFKTDPEQSEAEKEVLEGYTDMRIIITSGPIASDVTVIYGPF 909
            ...|   |...:|:|   .||||:|:.:      |.::......:.|.:..|.:..:|...:..:
  Fly   634 EFLFYEGAVGNNAEFLNRSSGAYIFRPN------ENKIHFATDQVEIEVYKGDLVHEVHQKFNDW 692

  Fly   910 LAHTVRIFNTRTH-----LDAAIYVENDIDFEPPPKNRETELFMRFVTNIDNIAQAPMQRDPLKE 969
            ::..||::|..::     |...|.:::.|.         .|:..||.::|.:..           
  Fly   693 ISQVVRVYNKDSYAEFEWLVGPIPIDDGIG---------KEVITRFNSDIASDG----------- 737

  Fly   970 PVDAATMPELPVFYSDQNGFQYHER---------IKVPAIGIEGNYFPITSGAFIQDSRLRLTLL 1025
                       :|.:|.||.:..:|         :|:.. .:.|||:|||:...::|...|:.:|
  Fly   738 -----------IFRTDSNGREMIKRKINHRDTWSVKINE-AVAGNYYPITTKIDVEDDTARMAIL 790

  Fly  1026 TTHAQGAASYEPGQLEVMLDRRTLYDDYRGMGEGVVD--------SRLTRHKFWLLVEDLPGGQH 1082
            |..|||.:|.:.|.||:|:.||.|.||..|:||.:.:        :|...|.|:....|..|   
  Fly   791 TDRAQGGSSLKDGSLELMVHRRLLKDDAFGVGEALNETEYGDGLIARGKHHLFFGKSTDREG--- 852

  Fly  1083 VTQPPSYKVLSQQAQQLANALRYPPNLYFVSNLE-------QPELAAALLPLVRLLPKGPLPCDV 1140
                    |..:..::|....:..|...|.||:|       |.........:..:|||     .|
  Fly   853 --------VSLKGIERLTQLEKLLPTWKFFSNMEDYSADEWQTAFTNIFSGISLVLPK-----PV 904

  Fly  1141 HLTTLRTLSDPELQLFPSASALLV----LHRQGFDCSVSAGRELSMEAICPLSS---KGL----- 1193
            ||.||....:         :.|||    :...|.|.|.|...:.:::.:  ||:   :|:     
  Fly   905 HLLTLEPWHE---------NQLLVRFEHIMENGEDASYSQPVQFNVKNV--LSAFDVEGIRETTL 958

  Fly  1194 -GNVQLG---RL----------------------SLHTIEATS-LTGTEQ--------KSSRESY 1223
             ||..|.   ||                      |:|.:.|.. :.|.:.        :...||.
  Fly   959 DGNAWLDESRRLQFAPDPEEAAFNTYATFSQPAESVHLLSAEKPMLGVKYADEALPAGQLGAESN 1023

  Fly  1224 HIRSLAE--------------------------------ISLEPMELRTF 1241
            .||...|                                |.|.|||:|||
  Fly  1024 RIRRETETRQEKKDEGRSSKSTEGPYNSFKSDSSNQEYIIELSPMEIRTF 1073

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-Man-IIbNP_001262614.1 PLN02701 148..1246 CDD:178304 290/1221 (24%)
GH38N_AMII_GMII_SfManIII_like 167..514 CDD:212120 102/366 (28%)
Alpha-mann_mid 508..596 CDD:286360 32/88 (36%)
Glyco_hydro_38C 813..1241 CDD:285047 117/542 (22%)
LManIINP_609408.1 GH38N_AMII_LAM_like 47..323 CDD:212121 82/304 (27%)
Alpha-mann_mid 370..445 CDD:214875 31/87 (36%)
Glyco_hydro_38C 502..957 CDD:285047 129/578 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64901482
eggNOG 1 0.900 E1_KOG1959
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001898
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11607
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.