DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5623 and CG13539

DIOPT Version :9

Sequence 1:NP_650485.1 Gene:CG5623 / 41904 FlyBaseID:FBgn0038357 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001286759.1 Gene:CG13539 / 37680 FlyBaseID:FBgn0034833 Length:260 Species:Drosophila melanogaster


Alignment Length:236 Identity:54/236 - (22%)
Similarity:99/236 - (41%) Gaps:38/236 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RAWPGARFMCVCKEGDLNTAAYCLAELMHEPFQPFPMATVAVHHSIRDEFIERVRSRFRQLKPHV 98
            ::|...|.|.:...||::.....:...|..|.....:|:|.|..|||||.|:|:|:..:.:...:
  Fly    36 KSWILPRMMVLFASGDMDQVIEAIVSDMIHPIGTGLVASVLVEESIRDEMIKRIRANLKPMSERI 100

  Fly    99 ANHPNFIRAV--------------------NELKYGLRPVKYILADVADAPACASPILVTGGVTH 143
            .:|||:::.|                    .:.:|| |.:|            .||::|. ....
  Fly   101 QHHPNYLKTVKLIDRMNCSTIHIEEFEESDTKKRYG-RRMK------------GSPLIVL-DFPQ 151

  Fly   144 LFFPSGPSGCTTLHTFSSMREVALIFGKETPKFDAVYFFDETITGVY-ILAKLINCVQFFVNC-M 206
            .:|...|:...|:.||.:|.||..:..:|...||.:..:...:...: :|.::....|:..|| .
  Fly   152 FYFGGKPTAIMTMSTFRNMNEVVKLHSREGLNFDCITVWSAKLAQCFDLLTRVPTVDQWTFNCTK 216

  Fly   207 DACLMEIMPHYLDHTPMVVYKRGYHYETLELDQQWKIIVFP 247
            ::..:..:|  ...|..|:..:..|||...:..:.|.|.||
  Fly   217 ESIKVPKLP--AQPTTTVIIVKNIHYEVHVIGGKIKTIAFP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5623NP_650485.1 DUF1487 35..252 CDD:254173 54/235 (23%)
CG13539NP_001286759.1 DUF1487 37..260 CDD:254173 54/235 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457903
Domainoid 1 1.000 69 1.000 Domainoid score I16590
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007614
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21644
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.