DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4520 and TOM40

DIOPT Version :8

Sequence 1:NP_001287340.1 Gene:CG4520 / 41902 FlyBaseID:FBgn0038355 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_188634.1 Gene:TOM40 / 821538 AraportID:AT3G20000 Length:309 Species:Arabidopsis thaliana

Alignment Length:332 Identity:63/333 (19%)
Similarity:114/333 (34%) Gaps:93/333 (28%)


  Fly    23 ERVSGHCNKKNPGNVQNLHILA-HRVMPKFYDGIELDYLHRLAPNKYITAAWVLSH--------- 77
            |:|. :.|..:|...:.||..| ..:....::|:..|:      .:.:...:.|||         
plant    21 EKVD-YSNLPSPVPYEELHREALMSLKSDNFEGLRFDF------TRALNQKFSLSHSVMMGPTEV 78

  Fly    78 ----------IRPSGFRFGGLY-------TFRVQDDTMYTPTIMGDIHPTSLAANLNILY----- 120
                      |..:.:.||..|       ..||..|......:..|: ...|....|.|.     
plant    79 PAQSPETTIKIPTAHYEFGANYYDPKLLLIGRVMTDGRLNARLKADL-TDKLVVKANALITNEEH 142

  Fly   121 -------YPFQSLRMEAVLQKAREAAVESQYTIEWTRPCDTWTANFYNVRNESGRCTMSVMRSVS 178
                   :.:......|.||..:.|.:.:.|                             ::||:
plant   143 MSQAMFNFDYMGSDYRAQLQLGQSALIGATY-----------------------------IQSVT 178

  Fly   179 AHWALGGELLLEW-NDPQKLTPDLALAARY-SHYNYSLAATASRQGLDVTYWQRIHPHIQMANLL 241
            .|.:||||:.  | ..|:|  ..:..|||| :....:....||...:.:.|.|:|...:.:|...
plant   179 NHLSLGGEIF--WAGVPRK--SGIGYAARYETDKMVASGQVASTGAVVMNYVQKISDKVSLATDF 239

  Fly   242 AWNRNTRKTIATICYQWNFWNSAVHGMFDSDASVGFMWTKYLTHLPLQMGFSVVMNLPTD----- 301
            .:|..:|...|::.|.:....:.|.|..||:.....:..:.|:     ||.:.:::...|     
plant   240 MYNYFSRDVTASVGYDYMLRQARVRGKIDSNGVASALLEERLS-----MGLNFLLSAELDHKKKD 299

  Fly   302 -RFAFGM 307
             :|.||:
plant   300 YKFGFGL 306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4520NP_001287340.1 Porin3_Tom40 33..312 CDD:132766 60/323 (19%)
TOM40NP_188634.1 Porin3_Tom40 28..309 CDD:132766 60/325 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1346842at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10802
Phylome 1 0.910 0.800 Consistency score
33.020

Return to query results.
Submit another query.