DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and SNP1

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_012203.1 Gene:SNP1 / 854749 SGDID:S000001323 Length:300 Species:Saccharomyces cerevisiae


Alignment Length:257 Identity:52/257 - (20%)
Similarity:95/257 - (36%) Gaps:68/257 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RPVDPP----PPLPNLRMKTNLI-------LNYLPQDMTESELHRLFS-KFGEIRKAKIIRHRRT 78
            ||.|.|    ...||:....||:       :...|:....:.|.|... |..:|:.|:::..|..
Yeast    26 RPTDYPYAKRQTNPNITGVANLLSTSLKHYMEEFPEGSPNNHLQRYEDIKLSKIKNAQLLDRRLQ 90

  Fly    79 GISCCYGFVDYVSERQAAAAVNGMDGYETRGKRLKVAFARPSEYESTSSSLYVGNLPTYMDEKKV 143
            ..:           ......:...|.|.|                     :::|.||..:||.::
Yeast    91 NWN-----------PNVDPHIKDTDPYRT---------------------IFIGRLPYDLDEIEL 123

  Fly   144 RELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVA--KYGM-------DRYMIEGASRP 199
            ::.|..:|.|..:.:::.|...:|:|.||:.|:....:::|  :.|:       ||..|....|.
Yeast   124 QKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKEIGVHRGIQIKDRICIVDIERG 188

  Fly   200 LTVKFVEREKKGSSSTSSGSQYKDKR---------KSSP------PPYKRRERTNDHHVSKR 246
            .|||:.:..:.|......|...:|.|         .|:|      |...|||.::..:.:.|
Yeast   189 RTVKYFKPRRLGGGLGGRGYSNRDSRLPGRFASASTSNPAERNYAPRLPRRETSSSAYSADR 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 12/83 (14%)
RRM 128..202 CDD:214636 20/82 (24%)
SNP1NP_012203.1 U1snRNP70_N 6..95 CDD:403437 15/79 (19%)
RRM_SNP1_like 89..201 CDD:410194 26/143 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.