DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and AT4G12640

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_193001.2 Gene:AT4G12640 / 826877 AraportID:AT4G12640 Length:823 Species:Arabidopsis thaliana


Alignment Length:282 Identity:67/282 - (23%)
Similarity:111/282 - (39%) Gaps:80/282 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 MFQTGRPVDPPPPLPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYG 85
            |.:.||..:||        ..:|.:..||..:.|.||...|.:|||:.....    :.|.|  |.
plant    11 MKEDGRGRNPP--------SRHLWVGNLPHGILERELADRFLRFGELESLAF----QPGRS--YA 61

  Fly    86 FVDYVSERQAAAAVNGMDGYETRGKRLKVAFARPSE----------------------------- 121
            ||::..:..|.||:..:.|:...|..|::.||:..:                             
plant    62 FVNFNHDEDAFAAIESLQGFPLSGNPLRIEFAKAEKSSTGSRTDDIYRHDEQRSAARGSSFVQRD 126

  Fly   122 ----YES---------------TSSSLYVGNLPTYM--DEKKVRELFATYGNIVDVNLLRHKFNN 165
                |||               .|..||:| .|..:  |:..:|.:|:::|.|..|.:    |..
plant   127 SRMRYESPDTYSKSKMNDRNAEPSEVLYIG-FPASLKVDDALLRNVFSSFGEITKVTV----FPG 186

  Fly   166 RSRGVAFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREKKGSSSTSSGSQYKDKRKSSPP 230
            ||  .||:||..:..|..||..:...:. |..| :.:.|.:     |..:||||......:|..|
plant   187 RS--YAFVQFRNLMAACKAKESLQGKLF-GNPR-VHICFAK-----SEPSSSGSGRGPSGRSLSP 242

  Fly   231 PYKRRER--TNDHHVSKRSRDS 250
            ||:..:|  :::.::..|:..|
plant   243 PYRSVDRLGSSEGYLQDRNYGS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 21/75 (28%)
RRM 128..202 CDD:214636 22/75 (29%)
AT4G12640NP_193001.2 RRM3_Spen 25..94 CDD:240756 22/74 (30%)
RRM_SF 153..223 CDD:302621 23/78 (29%)
SPOC 471..567 CDD:285043
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.