DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and Hnrnpr

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_006539285.1 Gene:Hnrnpr / 74326 MGIID:1891692 Length:635 Species:Mus musculus


Alignment Length:322 Identity:69/322 - (21%)
Similarity:124/322 - (38%) Gaps:96/322 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AGIRGMFQ-TGRPVD----------PPPP------LPNLRMKTNLILNYLPQDMTESELHRLFSK 63
            |.|:.:.: ||..:|          |||.      .|.:  .|.:.:..:|:|:.|.||..||.|
Mouse   125 AKIKALLERTGYTLDVTTGQRKYGGPPPDSVYSGVQPGI--GTEVFVGKIPRDLYEDELVPLFEK 187

  Fly    64 FGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMDGYETR-GKRLKVAFARPSEYESTSS 127
            .|.|...:::....:|.:..|.|:.:..:..|..||...|.||.| ||.|.|..:      ..::
Mouse   188 AGPIWDLRLMMDPLSGQNRGYAFITFCGKEAAQEAVKLCDSYEIRPGKHLGVCIS------VANN 246

  Fly   128 SLYVGNLPTYMDEKKVRELFA-----TYGNIVDVNLLRHKFNN--RSRGVAFLQFELVRDAEVAK 185
            .|:||::|....::.:.|.|:     |.| :||| :|.|:.::  ::||..||::|..:.|..|:
Mouse   247 RLFVGSIPKNKTKENILEEFSKVTGLTEG-LVDV-ILYHQPDDKKKNRGFCFLEYEDHKSAAQAR 309

  Fly   186 YGMDRYMIEGASRPLTVK----------------------------------------------- 203
            ..:....::.....:||:                                               
Mouse   310 RRLMSGKVKVWGNVVTVEWADPVEEPDPEVMAKVKVLFVRNLATTVTEEILEKSFSEFGKLERVK 374

  Fly   204 ------FVEREKKGSS----STSSGSQYKDKR----KSSPPPYKRRERTNDHHVSKRSRDSD 251
                  ||..|.:|::    ...:|.:.:.:.    .:.||..||:||......|:.:...|
Mouse   375 KLKDYAFVHFEDRGAAVKAMDEMNGKEIEGEEIEIVLAKPPDKKRKERQAARQASRSTAYED 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 25/76 (33%)
RRM 128..202 CDD:214636 20/80 (25%)
HnrnprXP_006539285.1 hnRNP_Q_AcD 37..106 CDD:375786
hnRNP-R-Q 106..630 CDD:273732 69/322 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.