Sequence 1: | NP_650473.1 | Gene: | CG5213 / 41892 | FlyBaseID: | FBgn0038345 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001157308.1 | Gene: | Pabpc6 / 67543 | MGIID: | 1914793 | Length: | 643 | Species: | Mus musculus |
Alignment Length: | 222 | Identity: | 55/222 - (24%) |
---|---|---|---|
Similarity: | 96/222 - (43%) | Gaps: | 38/222 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 TNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMDGY 105
Fly 106 ETRGKRLKVAFARPSEYEST----------------------------SSSLYVGNLPTYMDEKK 142
Fly 143 VRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVER 207
Fly 208 EKKGSSSTSSGSQYKDKRKSS---PPP 231 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5213 | NP_650473.1 | RRM1_Hu_like | 41..117 | CDD:240821 | 24/75 (32%) |
RRM | 128..202 | CDD:214636 | 21/73 (29%) | ||
Pabpc6 | NP_001157308.1 | PABP-1234 | 11..622 | CDD:130689 | 55/222 (25%) |
RRM1_I_PABPs | 12..91 | CDD:240824 | |||
RRM2_I_PABPs | 97..172 | CDD:240825 | |||
RRM3_I_PABPs | 190..269 | CDD:240826 | 25/78 (32%) | ||
RRM4_I_PABPs | 303..380 | CDD:240827 | 22/80 (28%) | ||
PABP | 554..621 | CDD:279051 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |