DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and Pabpc6

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001157308.1 Gene:Pabpc6 / 67543 MGIID:1914793 Length:643 Species:Mus musculus


Alignment Length:222 Identity:55/222 - (24%)
Similarity:96/222 - (43%) Gaps:38/222 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMDGY 105
            ||:.:..|.:||.:..|..||.:||.....|::.. .:|.|..:|||.:.....|..||..|:|.
Mouse   191 TNVYIKNLGEDMDDERLQDLFGRFGPALSVKVMTD-ESGKSKGFGFVSFERHEDARKAVEEMNGK 254

  Fly   106 ETRGKRLKVAFARPSEYEST----------------------------SSSLYVGNLPTYMDEKK 142
            :..||::.|..|:......|                            ..:|||.||...:|:::
Mouse   255 DLNGKQIYVGRAQKKVERQTELKHKFGQMKQDKHKIERVPQDRSVRCKGVNLYVKNLDDGIDDER 319

  Fly   143 VRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVER 207
            :|:.|:.:|.|....:...  ..||:|..|:.|....:|..|...|:..::  |::||.|...:|
Mouse   320 LRKEFSPFGTITSAKVTME--GGRSKGFGFVCFSSPEEATKAVTEMNGKIV--ATKPLYVALAQR 380

  Fly   208 EKKGSSSTSSGSQYKDKRKSS---PPP 231
            :::..:..|  :||..:..|:   |.|
Mouse   381 KEERQAHLS--NQYMQRMASTSAGPNP 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 24/75 (32%)
RRM 128..202 CDD:214636 21/73 (29%)
Pabpc6NP_001157308.1 PABP-1234 11..622 CDD:130689 55/222 (25%)
RRM1_I_PABPs 12..91 CDD:240824
RRM2_I_PABPs 97..172 CDD:240825
RRM3_I_PABPs 190..269 CDD:240826 25/78 (32%)
RRM4_I_PABPs 303..380 CDD:240827 22/80 (28%)
PABP 554..621 CDD:279051
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.