DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and Rbms1

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_006500003.1 Gene:Rbms1 / 56878 MGIID:1861774 Length:419 Species:Mus musculus


Alignment Length:250 Identity:62/250 - (24%)
Similarity:101/250 - (40%) Gaps:58/250 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KESSVPTLCWGYAGIRGMFQTGRPVDPPPPLP---------------NLRMKTNLILNYLPQDMT 53
            |:|.||               ..|:.||.|..               :...||||.:..||.:.|
Mouse    25 KQSLVP---------------AHPMAPPSPSTTSSNNNSSSSSNSGWDQLSKTNLYIRGLPPNTT 74

  Fly    54 ESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMDGYETRGKRLKVAFAR 118
            :.:|.:|...:|:|...|.|..:.|.....|||||:.|...|..||:.:   :..|.:.::|   
Mouse    75 DQDLVKLCQPYGKIVSTKAILDKATNKCKGYGFVDFDSPAAAQKAVSAL---KANGVQAQMA--- 133

  Fly   119 PSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEV 183
             .:.|...::||:.|||..|||:::..:...:|.::...:||.. :..||||.|.:.|.....|.
Mouse   134 -KQQEQDPTNLYISNLPLSMDEQELENMLKPFGQVISTRVLRDS-SGASRGVGFARMESTEKCEA 196

  Fly   184 ------AKYGMDRYMIEGASRPLTVKFVEREKKGSSSTSSGSQYKDKRKSSPPPY 232
                  .|:......:...:.||..||.:           |.|   |::.:|..|
Mouse   197 VIGHFNGKFIKTPPGVSAPTEPLLCKFAD-----------GGQ---KKRQNPNKY 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 24/75 (32%)
RRM 128..202 CDD:214636 21/79 (27%)
Rbms1XP_006500003.1 RRM1_MSSP1 55..140 CDD:240914 26/91 (29%)
RRM2_MSSP2 141..226 CDD:240918 23/96 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.