DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5213 and eif4b

Sequence 1:NP_650473.1 Gene:CG5213 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_012812217.1 Gene:eif4b XenbaseID:XB-GENE-988676 Length:614 Species:Xenopus tropicalis

Alignment Length:167 Identity:37/168 (22%)
Similarity:61/168 (36%) Gaps:43/168 (26%)


  Fly   123 ESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFN-NRSRGVAFLQFE----LVR--- 179
            :|...:.::||||..:.|:.:::.|... ||..|.|.|...| .|.:|..:.:|:    |:|   
 Frog   106 KSPPFTAFLGNLPYDVTEESIQKFFRGL-NISAVRLPREPSNPERLKGFGYAEFDDLDSLLRALS 169

  Fly   180 ----------------------DAEVAKYGMDR---------YMIEGASRPLTVKFVE-REKKGS 212
                                  |.:...:|.||         ...:..:||.|..|.: ..::|.
 Frog   170 LNEESLGNRRIRVDIADQAQDKDRDERSFGRDRDRNRESDKTDSSDWRARPSTDSFDDYPPRRGD 234

  Fly   213 SSTSSGSQYKDKRKSSPPPYKRRERTNDHHVSKRSRD 249
            .  |.|.:|:..|..|........|..|.:...|.||
 Frog   235 D--SQGDRYRSDRYESDRYRDGPRRDGDRYERDRGRD 269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821
RRM 128..202 CDD:214636 24/113 (21%)
eif4bXP_012812217.1 RRM <105..243 CDD:223796 30/140 (21%)
RRM_eIF4B 109..185 CDD:240848 17/77 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0118
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.