DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5213 and eif4h

Sequence 1:NP_650473.1 Gene:CG5213 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001184257.1 Gene:eif4h ZFINID:ZDB-GENE-010328-19 Length:262 Species:Danio rerio

Alignment Length:98 Identity:27/99 (27%)
Similarity:47/99 (47%) Gaps:15/99 (15%)


  Fly   119 PSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEV 183
            |:|...|:   ||||||....:..:..:|... ::..|.|:|.|..::.:|..:::|:   |.|.
Zfish    39 PTEPPYTA---YVGNLPFNTVQGDIDAIFRDL-SVRSVRLVRDKETDKFKGFCYVEFD---DLES 96

  Fly   184 AKYGMDRYMIEGA---SRPLTVKFVE--REKKG 211
            .|   :....:||   .|.|.|...|  |:::|
Zfish    97 LK---EALTYDGALLGDRSLRVDIAEGRRQERG 126

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821
RRM 128..202 CDD:214636 20/77 (26%)
eif4hNP_001184257.1 RRM <39..>118 CDD:223796 24/89 (27%)
RRM_eIF4H 43..118 CDD:240847 22/85 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0118
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.