powered by:
                  
 
    
 
    
             
          
            Protein Alignment CG5213 and RBMY1B
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_650473.1 | 
            Gene: | CG5213 / 41892 | 
            FlyBaseID: | FBgn0038345 | 
            Length: | 251 | 
            Species: | Drosophila melanogaster | 
          
          
            | Sequence 2: | NP_001006121.1 | 
            Gene: | RBMY1B / 378948 | 
            HGNCID: | 23914 | 
            Length: | 496 | 
            Species: | Homo sapiens | 
          
        
        
        
          
            | Alignment Length: | 110 | 
            Identity: | 34/110 - (30%) | 
          
          
            | Similarity: | 57/110 -  (51%) | 
            Gaps: | 15/110 - (13%) | 
          
        
      
- Green bases have known domain annotations that are detailed below.
      | 
 
  Fly   129 LYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMI 193 
            |::|.|....:||.::.:|..:|.|.:|.|::.: .::|||.||:.||...||:.|...|:...: 
Human    10 LFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDR-TSKSRGFAFITFENPADAKNAAKDMNGKSL 73 
 
  Fly   194 EGASRPLTVKFVEREKKGSSSTSSGSQYKDKRKSSPPPYKRRERT 238 
            .|.:    :| ||:.||  .|..||.:.:       ||...|.|: 
Human    74 HGKA----IK-VEQAKK--PSFQSGGRRR-------PPASSRNRS 104 
 
       | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | 
            Simple Score | 
            Weighted Score | 
            Original Tool Information | 
          
          
            | BLAST Result | 
            Score | 
            Score Type | 
            Cluster ID | 
          
          
          
            | Compara | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Domainoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | eggNOG | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Hieranoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Homologene | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Inparanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Isobase | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OMA | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoDB | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoFinder | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoInspector | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | orthoMCL | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Panther | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Phylome | 
            1 | 
            0.910 | 
            - | 
            - | 
             | 
             | 
          
          
            | RoundUp | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SonicParanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SwiftOrtho | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | TreeFam | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | User_Submission | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
             | 
            1 | 0.910 | 
             | 
          
        
      
           
             Return to query results.
             Submit another query.