| Sequence 1: | NP_650473.1 | Gene: | CG5213 / 41892 | FlyBaseID: | FBgn0038345 | Length: | 251 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011539191.1 | Gene: | ELAVL4 / 1996 | HGNCID: | 3315 | Length: | 416 | Species: | Homo sapiens | 
| Alignment Length: | 226 | Identity: | 82/226 - (36%) | 
|---|---|---|---|
| Similarity: | 121/226 - (53%) | Gaps: | 16/226 - (7%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    23 QTGRPVDPPPPLPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFV 87 
  Fly    88 DYVSERQAAAAVNGMDGYETRGKRLKVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGN 152 
  Fly   153 IVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREKKGSSSTSS 217 
  Fly   218 GSQYKDKRKSSPPPYKRRERTNDHHVSKRSR 248 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG5213 | NP_650473.1 | RRM1_Hu_like | 41..117 | CDD:240821 | 34/75 (45%) | 
| RRM | 128..202 | CDD:214636 | 26/73 (36%) | ||
| ELAVL4 | XP_011539191.1 | ELAV_HUD_SF | 79..415 | CDD:273741 | 78/219 (36%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000313 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||