DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and ELAVL1

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001410.2 Gene:ELAVL1 / 1994 HGNCID:3312 Length:326 Species:Homo sapiens


Alignment Length:211 Identity:76/211 - (36%)
Similarity:118/211 - (55%) Gaps:8/211 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMDG 104
            :||||:|||||:||:.||..|||..||:..||:||.:..|.|..||||:||:.:.|..|:|.::|
Human    19 RTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAINTLNG 83

  Fly   105 YETRGKRLKVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRG 169
            ...:.|.:||::||||......::||:..||..|.:|.|.::|:.:|.|::..:|..:....|||
Human    84 LRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVDQTTGLSRG 148

  Fly   170 VAFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREKKGSSSTSSGSQYKDKRKSSPPPYKR 234
            |||::|:...:||.|....:.:...|:|.|:||||.....:..:.......|....:....|.  
Human   149 VAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQNKNVALLSQLYHSPARRFGGPV-- 211

  Fly   235 RERTNDHHVSKRSRDS 250
                  ||.::|.|.|
Human   212 ------HHQAQRFRFS 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 37/75 (49%)
RRM 128..202 CDD:214636 24/73 (33%)
ELAVL1NP_001410.2 ELAV_HUD_SF 19..326 CDD:273741 76/211 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.