DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and Elavl3

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_034617.1 Gene:Elavl3 / 15571 MGIID:109157 Length:367 Species:Mus musculus


Alignment Length:229 Identity:81/229 - (35%)
Similarity:123/229 - (53%) Gaps:22/229 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PPLPNLRM----------KTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGF 86
            |.|||..:          |||||:|||||:||:.|...||...|:|...|::|.:.||.|..|||
Mouse    20 PALPNGPLLGTNGATDDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGF 84

  Fly    87 VDYVSERQAAAAVNGMDGYETRGKRLKVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYG 151
            |:|.....|..|:|.::|.:.:.|.:||::||||......::|||..||..|.:|::.:||:.||
Mouse    85 VNYSDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKEMEQLFSQYG 149

  Fly   152 NIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVER--EKKGSSS 214
            .|:...:|..:....||||.|::|:...:||.|..|::.....||:.|:||||...  :|.|.:.
Mouse   150 RIITSRILLDQATGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFANNPSQKTGQAL 214

  Fly   215 TSSGSQYKDKRKSSPPPYKRRERTNDHHVSKRSR 248
            .:...|...:|.:.|.          ||.::|.|
Mouse   215 LTHLYQSSARRYAGPL----------HHQTQRFR 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 33/75 (44%)
RRM 128..202 CDD:214636 26/73 (36%)
Elavl3NP_034617.1 ELAV_HUD_SF 36..366 CDD:273741 77/213 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.