DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and SF3B4

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_005841.1 Gene:SF3B4 / 10262 HGNCID:10771 Length:424 Species:Homo sapiens


Alignment Length:217 Identity:52/217 - (23%)
Similarity:101/217 - (46%) Gaps:22/217 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PLPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAA 97
            |:........:.:..|.:.::|..|..||.:.|.:....:.:.|.||....||||:::||..|..
Human     5 PISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADY 69

  Fly    98 AVNGMDGYETRGKRLKV--AFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDV-NLL 159
            |:..|:..:..||.::|  |.|.....: ..:::::|||...:|||.:.:.|:.:|.|:.. .::
Human    70 AIKIMNMIKLYGKPIRVNKASAHNKNLD-VGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIM 133

  Fly   160 RHKFNNRSRGVAFLQFELVRDAEVAKYGMD-RYMIEGASRPLTVKFV-EREKKGSSSTSSGSQYK 222
            |......|:|.||:.|.....::.|...|: :|:   .:||:||.:. :::.||....|:..:..
Human   134 RDPDTGNSKGYAFINFASFDASDAAIEAMNGQYL---CNRPITVSYAFKKDSKGERHGSAAERLL 195

  Fly   223 DKRK-------------SSPPP 231
            ..:.             .:|||
Human   196 AAQNPLSQADRPHQLFADAPPP 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 22/77 (29%)
RRM 128..202 CDD:214636 20/75 (27%)
SF3B4NP_005841.1 RRM1_SF3B4 15..88 CDD:409771 21/72 (29%)
RRM2_SF3B4 99..181 CDD:409772 22/84 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..424 3/11 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.