Sequence 1: | NP_650473.1 | Gene: | CG5213 / 41892 | FlyBaseID: | FBgn0038345 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005841.1 | Gene: | SF3B4 / 10262 | HGNCID: | 10771 | Length: | 424 | Species: | Homo sapiens |
Alignment Length: | 217 | Identity: | 52/217 - (23%) |
---|---|---|---|
Similarity: | 101/217 - (46%) | Gaps: | 22/217 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 PLPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAA 97
Fly 98 AVNGMDGYETRGKRLKV--AFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDV-NLL 159
Fly 160 RHKFNNRSRGVAFLQFELVRDAEVAKYGMD-RYMIEGASRPLTVKFV-EREKKGSSSTSSGSQYK 222
Fly 223 DKRK-------------SSPPP 231 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5213 | NP_650473.1 | RRM1_Hu_like | 41..117 | CDD:240821 | 22/77 (29%) |
RRM | 128..202 | CDD:214636 | 20/75 (27%) | ||
SF3B4 | NP_005841.1 | RRM1_SF3B4 | 15..88 | CDD:409771 | 21/72 (29%) |
RRM2_SF3B4 | 99..181 | CDD:409772 | 22/84 (26%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 207..424 | 3/11 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |