DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6118 and BtbVII

Sequence 1:NP_001097806.1 Gene:CG6118 FlyBaseID:FBgn0038339 Length:967 Species:Drosophila melanogaster
Sequence 2:NP_647774.2 Gene:BtbVII FlyBaseID:FBgn0263108 Length:907 Species:Drosophila melanogaster

Alignment Length:594 Identity:140/595 (24%)
Similarity:217/595 (36%) Gaps:167/595 (28%)


  Fly   389 TIDQYLLSWNNFHGNMCRGFHSLQKDEKMVDVTIAAGGKIFKAHKLVLSVCSPYFQQIFLENPSS 453
            ::.|:.|.|||...|......||..:..:||||:||.|:..:|||:|||.||.|||.:|..||..
  Fly     2 SVQQFCLRWNNHQPNFISVCSSLLHNGTLVDVTLAAEGRQLQAHKIVLSACSSYFQALFTTNPCQ 66

  Fly   454 HPILLMADVEASHMAGLLDFMYSGQVNVKYEDLPVFLKVAEAMKIKGLHTEKNLDSDASDIS--- 515
            |||:::.||:...:..::||||.|:|||..|.||..||.||.:|||||   ..:.:|.::::   
  Fly    67 HPIVILKDVQYDDLKTMVDFMYYGEVNVSQEQLPHILKTAEMLKIKGL---AEMPTDPANLTKSD 128

  Fly   516 SPHESDGTECRYERGTHSVNITSGHAAGYGGAPS------------------------------- 549
            |...:||||.   .|...|...:|::||..||.|                               
  Fly   129 SKSSTDGTEM---VGGAGVGTGAGNSAGSLGAGSGSSVGDSLWSSSEAQQFQQQQQQQAQQQAQQ 190

  Fly   550 ---------------------------------SQQSSPSPSL----NGPNRCPTPLSSGGSGNP 577
                                             .|||..:.:.    :...|.|:|||:|     
  Fly   191 QHHHHQQQQQLQQQQQQAQQQQQQQQHHHHHHQQQQSGQAQAAQTHHHQMRRTPSPLSAG----- 250

  Fly   578 NYAGFREHIKSKATLAETFMKNLNRNNNN-----NNSSNNYNH-----LGGSNGSLNLTEADSNS 632
                         |...|..|.|.:::||     ||:...:|.     .|..|..|:|.:.:..:
  Fly   251 -------------TSPATRRKRLRKSSNNGSGDRNNAEEQHNSSLDAGSGAGNAGLSLAQMNQMT 302

  Fly   633 FAILQANSKKMLDSARKQHKYLAKRKILMHYNTELGGEKRLKE---MERDRYPSAEQHDDALNNN 694
            |.                    |...:..|   .|...|.|||   .|.::.|    .|..|::.
  Fly   303 FG--------------------AGGGLAGH---SLHAAKLLKESASAELEQQP----QDSDLDDG 340

  Fly   695 HSHAQDNIMEPIITTIVPQTPPPSTHNNNFKIRLVESHHLTNNSNNNQNQSSNNNN--------S 751
            |.|....|...:....|.||.|.......     ..|.|...||.::.::.|..:.        .
  Fly   341 HGHLHMQIKPEVDIGGVNQTMPLDISGGT-----TPSEHDAPNSQSSHSEPSPAHAPHPPHPPLG 400

  Fly   752 SSSPQSNDCNNDEEALNLVQIPNANGSRNREATPTCATPTPDIQLIKREVKTELSP-----AENL 811
            ::|..|....:.|.:.::      .|..:.|..|.....:|.:...||.......|     ::::
  Fly   401 AASSSSGGSGSFERSFSI------GGVGSVECDPDGTPSSPAVMGTKRNRVLTRQPRVKRDSDSI 459

  Fly   812 SNNNGHDDEMAGAGFDRKYDDNNNNSGLDMETDSNNNNSKPGGDNNNGLALALGKHKLLSA---I 873
            |:.|....:.|....|   .|..|.:|....|  ..:.|..|..:.:..:.....|.||:.   |
  Fly   460 SSTNQISPDTAATTLD---FDPFNAAGATSAT--ARDYSTTGSHHLHHQSAVHHHHHLLTVPPRI 519

  Fly   874 NRNIEQDHP 882
            .|:..:..|
  Fly   520 ERHASEPAP 528

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6118NP_001097806.1 Myb_DNA-bind_4 20..97 CDD:290549
BTB 408..508 CDD:279045 48/100 (48%)
BTB 419..510 CDD:197585 45/91 (49%)
BtbVIINP_647774.2 BTB 24..117 CDD:279045 47/96 (49%)
BTB 32..117 CDD:197585 45/88 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000318
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23110
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.