| Sequence 1: | NP_001097806.1 | Gene: | CG6118 / 41884 | FlyBaseID: | FBgn0038339 | Length: | 967 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_647774.2 | Gene: | BtbVII / 38376 | FlyBaseID: | FBgn0263108 | Length: | 907 | Species: | Drosophila melanogaster |
| Alignment Length: | 594 | Identity: | 140/594 - (23%) |
|---|---|---|---|
| Similarity: | 217/594 - (36%) | Gaps: | 167/594 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 389 TIDQYLLSWNNFHGNMCRGFHSLQKDEKMVDVTIAAGGKIFKAHKLVLSVCSPYFQQIFLENPSS 453
Fly 454 HPILLMADVEASHMAGLLDFMYSGQVNVKYEDLPVFLKVAEAMKIKGLHTEKNLDSDASDIS--- 515
Fly 516 SPHESDGTECRYERGTHSVNITSGHAAGYGGAPS------------------------------- 549
Fly 550 ---------------------------------SQQSSPSPSL----NGPNRCPTPLSSGGSGNP 577
Fly 578 NYAGFREHIKSKATLAETFMKNLNRNNNN-----NNSSNNYNH-----LGGSNGSLNLTEADSNS 632
Fly 633 FAILQANSKKMLDSARKQHKYLAKRKILMHYNTELGGEKRLKE---MERDRYPSAEQHDDALNNN 694
Fly 695 HSHAQDNIMEPIITTIVPQTPPPSTHNNNFKIRLVESHHLTNNSNNNQNQSSNNNN--------S 751
Fly 752 SSSPQSNDCNNDEEALNLVQIPNANGSRNREATPTCATPTPDIQLIKREVKTELSP-----AENL 811
Fly 812 SNNNGHDDEMAGAGFDRKYDDNNNNSGLDMETDSNNNNSKPGGDNNNGLALALGKHKLLSA---I 873
Fly 874 NRNIEQDHP 882 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6118 | NP_001097806.1 | Myb_DNA-bind_4 | 20..97 | CDD:290549 | |
| BTB | 408..508 | CDD:279045 | 48/99 (48%) | ||
| BTB | 419..510 | CDD:197585 | 45/90 (50%) | ||
| BtbVII | NP_647774.2 | BTB | 24..117 | CDD:279045 | 47/95 (49%) |
| BTB | 32..117 | CDD:197585 | 45/87 (52%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 68 | 1.000 | Domainoid score | I9675 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1229475at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0000141 | |
| OrthoInspector | 1 | 1.000 | - | - | otm40394 | |
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR23110 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 6 | 6.020 | |||||