DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6171 and Aplf

Sequence 1:NP_001097801.1 Gene:CG6171 FlyBaseID:FBgn0026737 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001163960.1 Gene:Aplf MGIID:1919353 Length:499 Species:Mus musculus

Alignment Length:252 Identity:80/253 (32%)
Similarity:114/253 (45%) Gaps:41/253 (16%)


  Fly     9 ADSGAKRKSSEDITHNCNANFGAENGLRKRVKSEEPVASIKDETNPEVPMKIKAEPVENADEPTS 73
            ||......|||::..:.::|...:..: ..||:.:....|..|...|| .|.||......:|...
Mouse   259 ADQEGPGVSSENVPESSSSNIVKDPDV-DIVKTNKQKDGILIEELGEV-SKHKAATKPTTNEEGE 321

  Fly    74 TTPAIKIKAEP-ADNGNSPAAAMVKTEPTNSNAQDA------ADESTVSSSSIRTSCRFGIRCYR 131
            :...::.|:.| ...|..|.::...:.|...:...|      ::||.|.    ||:|.:|..|||
Mouse   322 SCARVQSKSPPEKSQGCHPESSSAPSSPDALHTDTADPVLGCSEESKVR----RTACMYGANCYR 382

  Fly   132 RNPAHRSAEAHPGDQDYRRPNFPAPPLGT--------PACPFGNACYRRNPVHFQDYSHPADFNS 188
            |||.|....:||||.||...:      ||        |.||:|.:|||:||.|..:|.|.|    
Mouse   383 RNPLHFQHFSHPGDSDYGEVH------GTDEGVIGDRPECPYGASCYRKNPQHKMEYRHSA---- 437

  Fly   189 AQNIRNRLRQRRAQRQNDDDSG--TDEEDEPFGGDNDRDADYRPGADINEDED-DEL 242
                   |..|.|..::|||.|  :|:|||......|.|:|:.||.|..|.|| |||
Mouse   438 -------LPARVALDEDDDDVGQPSDDEDEEDYEPTDEDSDWHPGKDDEEQEDVDEL 487

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6171NP_001097801.1 zf-CCHH 122..142 CDD:287283 9/20 (45%)
zf-CCHH 161..182 CDD:287283 11/21 (52%)
AplfNP_001163960.1 FHA 5..102 CDD:238017
zf-CCHH 374..393 CDD:287283 9/19 (47%)
Flexible linker. {ECO:0000250} 401..411 2/16 (13%)
zf-CCHH 414..435 CDD:287283 11/21 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C227350452
eggNOG 1 0.900 E1_290VG
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S8233
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007949
OrthoInspector 1 1.000 T1082380
orthoMCL 1 0.900 OOG5_135347
Panther 1 1.100 LDO PTHR21315
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4471
TreeFam 1 0.960
109.770

Return to query results.
Submit another query.