DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6171 and Aplf

Sequence 1:NP_001097801.1 Gene:CG6171 FlyBaseID:FBgn0026737 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_008761298.1 Gene:Aplf RGDID:1565557 Length:510 Species:Rattus norvegicus

Alignment Length:225 Identity:72/226 (32%)
Similarity:103/226 (46%) Gaps:39/226 (17%)


  Fly    39 VKSEEPVASIKDETNPEVPM-KIKAEPVENADEPTSTTPAIKIKAE-----PADNGNSPAAAMVK 97
            ||:.:...:|..|...|.|. |...:|..|..:.|.:.|..:...:     ....|..|.::...
  Rat   292 VKANKLSDTISAEELGEAPKHKAVTKPTTNDKDKTMSHPKCRAGVQSKTFLEKSQGCHPESSSAP 356

  Fly    98 TEPTNSNAQDA------ADESTVSSSSIRTSCRFGIRCYRRNPAHRSAEAHPGDQDYRRPNFPAP 156
            :.|..|:...|      ::||.|.    ||||.:|..|||:||.|....:||||.||..  .|..
  Rat   357 SSPGASHTDTADSVLGCSEESKVR----RTSCMYGANCYRKNPLHFQHFSHPGDSDYGA--VPVT 415

  Fly   157 PLGT----PACPFGNACYRRNPVHFQDYSHPADFNSAQNIRNRLRQRRAQRQNDDDSG----TDE 213
            ..|.    |.||:|.:|||:||.|..:|.|.|           |..|.|..::|||.|    :|:
  Rat   416 DEGVTGDRPECPYGASCYRKNPQHRMEYRHSA-----------LPARVAVDEDDDDVGQPSDSDK 469

  Fly   214 EDEPFGGDNDRDADYRPGADINEDED-DEL 242
            ::|.: ...|.|:|::||.|..|.|| |||
  Rat   470 DEEDY-APTDEDSDWQPGKDDEEKEDVDEL 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6171NP_001097801.1 zf-CCHH 122..142 CDD:287283 9/20 (45%)
zf-CCHH 161..182 CDD:287283 11/21 (52%)
AplfXP_008761298.1 FHA 4..102 CDD:238017
zf-CCHH 383..403 CDD:287283 9/20 (45%)
zf-CCHH 424..445 CDD:287283 11/21 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C227349791
eggNOG 1 0.900 E1_290VG
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007949
OrthoInspector 1 1.000 T1085978
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR21315
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.