DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6171 and APLF

Sequence 1:NP_001097801.1 Gene:CG6171 FlyBaseID:FBgn0026737 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_775816.1 Gene:APLF HGNCID:28724 Length:511 Species:Homo sapiens

Alignment Length:295 Identity:76/296 (26%)
Similarity:116/296 (39%) Gaps:83/296 (28%)


  Fly     7 STADSGAKRKSSEDITHNCNA--NFGAENGLRKRVKSEEPVASIKDETNPEVPMKIKAEPVENAD 69
            :|...|.::..|...:.|.:|  :.|.|   .|....||...|.|     |:|....|..:.|.:
Human   227 NTTQQGRRQLISSGSSENTSAEQDTGEE---CKNTDQEESTISSK-----EMPQSFSAITLSNTE 283

  Fly    70 EPTSTTPA-----------------IKIKAEP---------ADNGNSPAAAMVKTEPTNSNAQDA 108
            .....|.|                 |..|..|         ::|.:|.....::.|...|:::.:
Human   284 MNNIKTNAQRNKLPIEELGKVSKHKIATKRTPHKEDEAMSCSENCSSAQGDSLQDESQGSHSESS 348

  Fly   109 ADES------TVSSSSI----------RTSCRFGIRCYRRNPAHRSAEAHPGDQDYRRPNFPAPP 157
            ::.|      ..::.|:          ||||.:|..|||:||.|....:||||.||.....    
Human   349 SNPSNPETLHAKATDSVLQGSEGNKVKRTSCMYGANCYRKNPVHFQHFSHPGDSDYGGVQI---- 409

  Fly   158 LG------TPACPFGNACYRRNPVHFQDYSHPADFNSAQNIRNRLRQRRAQRQND---------- 206
            :|      .|.||:|.:|||:||.|..:|.|     :...:||.|     ...||          
Human   410 VGQDETDDRPECPYGPSCYRKNPQHKIEYRH-----NTLPVRNVL-----DEDNDNVGQPNEYDL 464

  Fly   207 DDSGTDEEDEPFGGDNDRDADYRPGADINEDEDDE 241
            :||..|:|:|.: ...|.|:|:.||.:..|.||.|
Human   465 NDSFLDDEEEDY-EPTDEDSDWEPGKEDEEKEDVE 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6171NP_001097801.1 zf-CCHH 122..142 CDD:287283 9/20 (45%)
zf-CCHH 161..182 CDD:287283 11/21 (52%)
APLFNP_775816.1 FHA <21..102 CDD:238017
zf-CCHH 378..401 CDD:313506 12/23 (52%)
Flexible linker 406..416 1/14 (7%)
zf-CCHH 420..440 CDD:313506 10/20 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_290VG
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S8233
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007949
OrthoInspector 1 1.000 T1072316
orthoMCL 1 0.900 OOG5_135347
Panther 1 1.100 LDO PTHR21315
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4471
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.