DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6171 and aplf

Sequence 1:NP_001097801.1 Gene:CG6171 FlyBaseID:FBgn0026737 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_012818115.1 Gene:aplf XenbaseID:XB-GENE-962442 Length:509 Species:Xenopus tropicalis

Alignment Length:261 Identity:71/262 (27%)
Similarity:111/262 (42%) Gaps:79/262 (30%)


  Fly    16 KSSEDITHNCNANFGAENGLRKRVKSEEPVASIKDETNPEVPMKIKAEPVENADEPTSTTPAIKI 80
            ||::|..:||           ..|:|.:   :||:.||.           .:.:..:::|...:|
 Frog   281 KSNDDDKNNC-----------LDVESNQ---NIKEVTNR-----------YSENRQSNSTSVKQI 320

  Fly    81 KAEPADNGNSPAAAMVKTEPTNSNAQDAADESTVSSS--------SIRTSCRFGIRCYRRNPAHR 137
            ||..:...::...::...|          |||:..::        :.||.|.:|..|||:||||.
 Frog   321 KASTSKTSHNDDLSLSPEE----------DESSEKANFNGGHEAVNRRTPCMYGENCYRKNPAHF 375

  Fly   138 SAEAHPGDQDYRRPNFPAPPLGT-------PACPFGNACYRRNPVHFQDYSHPADFNSAQNIRNR 195
            ....||||:||....     .|:       |.||:|..|||:||.|..:|.|.......   ..|
 Frog   376 EEFCHPGDRDYDNTE-----KGSQDDSDERPECPYGTDCYRKNPQHKLEYKHTKPPGKG---GRR 432

  Fly   196 LRQRRAQRQN---DDDSGT---------------DEEDEPFGGDN-DRDADYRPGADINEDEDDE 241
            ||:|.|::..   ||||..               |:|:|.|  || |.|:|:.|.::..:.||.:
 Frog   433 LRKRPAKKGKSVLDDDSDNDGDPNEYDLEDSFLDDDEEEDF--DNTDEDSDWMPDSEEKDTEDMK 495

  Fly   242 L 242
            |
 Frog   496 L 496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6171NP_001097801.1 zf-CCHH 122..142 CDD:287283 9/20 (45%)
zf-CCHH 161..182 CDD:287283 11/21 (52%)
aplfXP_012818115.1 zf-CCHH 360..380 CDD:287283 9/20 (45%)
zf-CCHH 401..422 CDD:287283 11/21 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C227346537
eggNOG 1 0.900 E1_290VG
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007949
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4471
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.