DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg4b and Atg4b

DIOPT Version :8

Sequence 1:NP_650452.1 Gene:Atg4b / 41868 FlyBaseID:FBgn0038325 Length:668 Species:Drosophila melanogaster
Sequence 2:NP_777363.1 Gene:Atg4b / 66615 MGIID:1913865 Length:393 Species:Mus musculus

Alignment Length:403 Identity:126/403 - (31%)
Similarity:185/403 - (45%) Gaps:98/403 - (24%)


  Fly   174 QPVWLLGRCYHRRFTPPVSMESSITELPSGADTTPDNATSAFDSIQATSTSTSLYPALNPQQIDE 238
            :|||:|||.|           |..||.                                    ||
Mouse    24 EPVWILGRKY-----------SIFTEK------------------------------------DE 41

  Fly   239 IVVPQELGMDAVENQVGEQPWEEGIEGFRRDFYSRIWMTYRREFPIMNGSNYTSDCGWGCMLRSG 303
            |:                           .|..||:|.||||.||.:.|:..|||.|||||||.|
Mouse    42 IL---------------------------SDVASRLWFTYRRNFPAIGGTGPTSDTGWGCMLRCG 79

  Fly   304 QMLFAQGLICHFLGRSWRYDSESQLHSTYEDNMHKKIVKWFGDSSSKSSPFSIHALVRLGEHLGK 368
            ||:|||.|:|..|||.||:....:...:|.:     ::..|.|  .|.|.:|||.:.::|...||
Mouse    80 QMIFAQALVCRHLGRDWRWTQRKRQPDSYFN-----VLNAFLD--RKDSYYSIHQIAQMGVGEGK 137

  Fly   369 KPGDWYGPASVSYLLKHALEHAAQENADFD---NISVYVAKDCTIYLQDIEDQCSIPEP----AP 426
            ..|.||||.:|:.:||        :.|.||   :::|::|.|.|:.:::|...|....|    |.
Mouse   138 SIGQWYGPNTVAQVLK--------KLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRANLPCVGAAA 194

  Fly   427 KPHVPWQQAKRPQAETTKTEQQQHWKSLIVLIPLRLGSDKLNPVYAHCLKLLLSTEHCLGILGGK 491
            .|....:......|....|.:...|:.|::|||||||...:|..|...||........||::|||
Mouse   195 LPTDSERHCNGFPAGAEVTNRPSAWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGK 259

  Fly   492 PKHSLYFVGFQEDRLIHLDPHYCQEMVDVNQENF-SLHSFHCK-SPRKLKASKMDPSCCIGFYCA 554
            |..:.||:|:..:.||:||||..|..|::....| ...||||: .|.::...::|||..:||:|.
Mouse   260 PNSAHYFIGYVGEELIYLDPHTTQPAVELTDSCFIPDESFHCQHPPSRMGIGELDPSIAVGFFCK 324

  Fly   555 TKSDFDNFMESVQ 567
            |:.||:::.:.|:
Mouse   325 TEEDFNDWCQQVK 337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atg4bNP_650452.1 Peptidase_C54 264..565 CDD:281417 112/309 (36%)
Atg4bNP_777363.1 Peptidase_C54 40..335 CDD:281417 86/301 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2674
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000311
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127111
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R109
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.