DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trs33 and AT3G05000

Sequence 1:NP_650450.1 Gene:Trs33 FlyBaseID:FBgn0266722 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_187151.1 Gene:AT3G05000 AraportID:AT3G05000 Length:173 Species:Arabidopsis thaliana

Alignment Length:169 Identity:67/170 (39%)
Similarity:96/170 (56%) Gaps:33/170 (19%)


  Fly    13 EIVNYCLD---------------SNKEHDLAT--LEYIGFTTGYRLIERLTREVSRFKDELETMK 60
            |:...|:|               :||. :||.  :|.||:..|::|.||.|.|..||.|.||.:|
plant     4 EVAESCVDTMLMEMVAMYSGRFYANKP-ELAARRIEAIGYQVGHQLSERYTMERPRFSDHLEAIK 67

  Fly    61 FICTDFWMLIYKKQVDNLRTNNHGMYVVQDKAFRFLTRIS--------------PG-TKQLEHAP 110
            |||.|||..::|||:|||:||:.|.:|:||..||:|:|:|              || :|..:...
plant    68 FICKDFWSEVFKKQIDNLKTNHRGTFVLQDNKFRWLSRVSIDPSSENETQDPSTPGESKAAQAVS 132

  Fly   111 KFVAFTCGLVRGALSNLGINSTVTAEVQSIPACKFHIEV 149
            .::.|.||::||.||||||...|:|::.|:|.|.|.|.|
plant   133 MYLYFPCGIIRGVLSNLGIPCAVSADISSLPTCSFVIRV 171

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trs33NP_650450.1 TRAPPC6A_Trs33 4..150 CDD:271347 67/170 (39%)
AT3G05000NP_187151.1 TRAPPC6A_Trs33 6..172 CDD:271347 66/168 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H42466
Inparanoid 1 1.050 121 1.000 Inparanoid score I1919
OMA 1 1.010
OrthoDB 1 1.010 D1566836at2759
OrthoInspector 1 1.000 T192299
orthoMCL 1 0.900 OOG5_129131
Panther 1 1.100 LDO PTHR12817
Phylome 1 0.910 0.800 Consistency score
98.980

Return to query results.
Submit another query.