DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trs33 and TRAPPC6A

Sequence 1:NP_650450.1 Gene:Trs33 FlyBaseID:FBgn0266722 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_077013.1 Gene:TRAPPC6A HGNCID:23069 Length:173 Species:Homo sapiens

Alignment Length:173 Identity:71/174 (41%)
Similarity:106/174 (61%) Gaps:21/174 (12%)


  Fly     1 MSEEILFDCLHAEIVN--YCLD-------------------SNKEHDLATLEYIGFTTGYRLIER 44
            |::.:||:.||.|:|.  :..|                   ..::..|:.||.:||..|..|.||
Human     1 MADTVLFEFLHTEMVAELWAHDPDPGPGVSAGLRGEEAGATKGQKMSLSVLEGMGFRVGQALGER 65

  Fly    45 LTREVSRFKDELETMKFICTDFWMLIYKKQVDNLRTNNHGMYVVQDKAFRFLTRISPGTKQLEHA 109
            |.||...|::||:.:||:|.|.|:.:::||:|:||||:.|.||:||.:|..|..::.|.:.||.|
Human    66 LPRETLAFREELDVLKFLCKDLWVAVFQKQMDSLRTNHQGTYVLQDNSFPLLLPMASGLQYLEEA 130

  Fly   110 PKFVAFTCGLVRGALSNLGINSTVTAEVQSIPACKFHIEVNRN 152
            |||:||||||:||||..|||.|.|||.|.::|.|||.:.:.::
Human   131 PKFLAFTCGLLRGALYTLGIESVVTASVAALPVCKFQVVIPKS 173

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trs33NP_650450.1 TRAPPC6A_Trs33 4..150 CDD:271347 70/167 (42%)
TRAPPC6ANP_077013.1 TRAPPC6A_Trs33 3..171 CDD:271347 70/168 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C270202010
eggNOG 1 0.900 E1_KOG3316
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 174 1.000 Inparanoid score I4007
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1566836at2759
OrthoFinder 1 1.000 FOG0001816
OrthoInspector 1 1.000 T609724
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12817
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2318
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.890

Return to query results.
Submit another query.