DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trs33 and TRAPPC6A

DIOPT Version :9

Sequence 1:NP_650450.1 Gene:Trs33 / 41866 FlyBaseID:FBgn0266722 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_077013.1 Gene:TRAPPC6A / 79090 HGNCID:23069 Length:173 Species:Homo sapiens


Alignment Length:173 Identity:71/173 - (41%)
Similarity:106/173 - (61%) Gaps:21/173 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEEILFDCLHAEIVN--YCLD-------------------SNKEHDLATLEYIGFTTGYRLIER 44
            |::.:||:.||.|:|.  :..|                   ..::..|:.||.:||..|..|.||
Human     1 MADTVLFEFLHTEMVAELWAHDPDPGPGVSAGLRGEEAGATKGQKMSLSVLEGMGFRVGQALGER 65

  Fly    45 LTREVSRFKDELETMKFICTDFWMLIYKKQVDNLRTNNHGMYVVQDKAFRFLTRISPGTKQLEHA 109
            |.||...|::||:.:||:|.|.|:.:::||:|:||||:.|.||:||.:|..|..::.|.:.||.|
Human    66 LPRETLAFREELDVLKFLCKDLWVAVFQKQMDSLRTNHQGTYVLQDNSFPLLLPMASGLQYLEEA 130

  Fly   110 PKFVAFTCGLVRGALSNLGINSTVTAEVQSIPACKFHIEVNRN 152
            |||:||||||:||||..|||.|.|||.|.::|.|||.:.:.::
Human   131 PKFLAFTCGLLRGALYTLGIESVVTASVAALPVCKFQVVIPKS 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trs33NP_650450.1 TRAPPC6A_Trs33 4..150 CDD:271347 70/166 (42%)
TRAPPC6ANP_077013.1 TRAPPC6A_Trs33 3..171 CDD:271347 70/167 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147948
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3316
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 174 1.000 Inparanoid score I4071
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566836at2759
OrthoFinder 1 1.000 - - FOG0002452
OrthoInspector 1 1.000 - - otm41260
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12817
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2318
SonicParanoid 1 1.000 - - X1632
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.890

Return to query results.
Submit another query.