DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trs33 and trappc6b

DIOPT Version :9

Sequence 1:NP_650450.1 Gene:Trs33 / 41866 FlyBaseID:FBgn0266722 Length:152 Species:Drosophila melanogaster
Sequence 2:XP_002933768.1 Gene:trappc6b / 779535 XenbaseID:XB-GENE-1000721 Length:164 Species:Xenopus tropicalis


Alignment Length:159 Identity:81/159 - (50%)
Similarity:113/159 - (71%) Gaps:9/159 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEEILFDCLHAEIVNYCL--------DSNKEHDLATLEYIGFTTGYRLIERLTREVSRFKDELE 57
            |::|.||..||.|::: |:        |:.....:..||.:||..|..||||.|::.:||||||:
 Frog     6 MADEALFLLLHNEVIS-CVYKAGGDQGDAENGKCITKLENMGFRVGQGLIERFTKDTARFKDELD 69

  Fly    58 TMKFICTDFWMLIYKKQVDNLRTNNHGMYVVQDKAFRFLTRISPGTKQLEHAPKFVAFTCGLVRG 122
            .|||:|.|||..::|||:||||||:.|:||:||..||.:|::|.|.:.||||||::||:|||:||
 Frog    70 IMKFVCKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLITQMSAGKQYLEHAPKYLAFSCGLIRG 134

  Fly   123 ALSNLGINSTVTAEVQSIPACKFHIEVNR 151
            .||||||.|.|||||..:|||||.:.:.:
 Frog   135 GLSNLGIKSIVTAEVSVMPACKFQVMIQK 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trs33NP_650450.1 TRAPPC6A_Trs33 4..150 CDD:271347 80/153 (52%)
trappc6bXP_002933768.1 TRAPPC6A_Trs33 8..162 CDD:271347 80/154 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 164 1.000 Domainoid score I3891
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H42466
Inparanoid 1 1.050 170 1.000 Inparanoid score I4004
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566836at2759
OrthoFinder 1 1.000 - - FOG0002452
OrthoInspector 1 1.000 - - otm48469
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1632
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.