DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trs33 and trappc6b

Sequence 1:NP_650450.1 Gene:Trs33 FlyBaseID:FBgn0266722 Length:152 Species:Drosophila melanogaster
Sequence 2:XP_002933768.1 Gene:trappc6b XenbaseID:XB-GENE-1000721 Length:164 Species:Xenopus tropicalis

Alignment Length:159 Identity:81/160 (51%)
Similarity:113/160 (71%) Gaps:9/160 (6%)


  Fly     1 MSEEILFDCLHAEIVNYCL--------DSNKEHDLATLEYIGFTTGYRLIERLTREVSRFKDELE 57
            |::|.||..||.|::: |:        |:.....:..||.:||..|..||||.|::.:||||||:
 Frog     6 MADEALFLLLHNEVIS-CVYKAGGDQGDAENGKCITKLENMGFRVGQGLIERFTKDTARFKDELD 69

  Fly    58 TMKFICTDFWMLIYKKQVDNLRTNNHGMYVVQDKAFRFLTRISPGTKQLEHAPKFVAFTCGLVRG 122
            .|||:|.|||..::|||:||||||:.|:||:||..||.:|::|.|.:.||||||::||:|||:||
 Frog    70 IMKFVCKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLITQMSAGKQYLEHAPKYLAFSCGLIRG 134

  Fly   123 ALSNLGINSTVTAEVQSIPACKFHIEVNR 151
            .||||||.|.|||||..:|||||.:.:.:
 Frog   135 GLSNLGIKSIVTAEVSVMPACKFQVMIQK 163

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trs33NP_650450.1 TRAPPC6A_Trs33 4..150 CDD:271347 80/154 (52%)
trappc6bXP_002933768.1 TRAPPC6A_Trs33 8..162 CDD:271347 80/155 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C270201853
eggNOG 1 0.900 E1_KOG3316
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H42466
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1566836at2759
OrthoFinder 1 1.000 FOG0001816
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.