DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trs33 and Trappc6a

Sequence 1:NP_650450.1 Gene:Trs33 FlyBaseID:FBgn0266722 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001102880.1 Gene:Trappc6a RGDID:1591735 Length:159 Species:Rattus norvegicus

Alignment Length:159 Identity:70/160 (44%)
Similarity:100/160 (63%) Gaps:7/160 (4%)


  Fly     1 MSEEILFDCLHAEIVN--YCLD-----SNKEHDLATLEYIGFTTGYRLIERLTREVSRFKDELET 58
            |::.:||:.||.|:|.  :..|     ..|:..|:.||.:||..|..|.|||.||....::||:.
  Rat     1 MADAVLFEFLHTEMVAELWAPDPDPGSGGKKKSLSVLEGLGFRVGQALGERLPRETLAVREELDA 65

  Fly    59 MKFICTDFWMLIYKKQVDNLRTNNHGMYVVQDKAFRFLTRISPGTKQLEHAPKFVAFTCGLVRGA 123
            :||:|.|.|..:::|.:|.||||:.|.||:||.:|..|..:..|.:.||.||||:||||||:.||
  Rat    66 LKFLCKDLWAAMFQKHMDGLRTNHQGTYVLQDNSFPLLIPMGSGPQYLEEAPKFLAFTCGLLCGA 130

  Fly   124 LSNLGINSTVTAEVQSIPACKFHIEVNRN 152
            |..||..|.|||.|.|:|||||.:.:.::
  Rat   131 LHTLGFQSLVTASVASLPACKFQVVIQKS 159

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trs33NP_650450.1 TRAPPC6A_Trs33 4..150 CDD:271347 69/153 (45%)
Trappc6aNP_001102880.1 TRAPPC6A_Trs33 3..157 CDD:271347 69/154 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C270199687
eggNOG 1 0.900 E1_KOG3316
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1566836at2759
OrthoFinder 1 1.000 FOG0001816
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12817
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
65.900

Return to query results.
Submit another query.