DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trs33 and Trappc6a

Sequence 1:NP_650450.1 Gene:Trs33 FlyBaseID:FBgn0266722 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001318110.1 Gene:Trappc6a MGIID:1914341 Length:183 Species:Mus musculus

Alignment Length:158 Identity:69/159 (43%)
Similarity:96/159 (60%) Gaps:7/159 (4%)


  Fly     1 MSEEILFDCLHAEIVN--YCLD-----SNKEHDLATLEYIGFTTGYRLIERLTREVSRFKDELET 58
            |::.:||:.||.|:|.  :..|     ..|...|:.||.:||..|..|.|||..|...|::||:.
Mouse     1 MADAVLFEFLHTEMVAELWAPDPDPGSGGKRRSLSVLEGLGFRVGQALGERLPLETPAFREELDA 65

  Fly    59 MKFICTDFWMLIYKKQVDNLRTNNHGMYVVQDKAFRFLTRISPGTKQLEHAPKFVAFTCGLVRGA 123
            :||:|.|.|..:::|.:|.||||:.|.||:||.:|..|..:..|.:.||.||||:||||||:.||
Mouse    66 LKFLCRDLWAAMFQKHMDGLRTNHQGTYVLQDNSFPLLVTMGSGPQYLEEAPKFLAFTCGLLCGA 130

  Fly   124 LSNLGINSTVTAEVQSIPACKFHIEVNR 151
            |..||..|.|||.|.|:|||:.....:|
Mouse   131 LHTLGFQSLVTASVASLPACRLEAGAHR 158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trs33NP_650450.1 TRAPPC6A_Trs33 4..150 CDD:271347 67/153 (44%)
Trappc6aNP_001318110.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C270199847
eggNOG 1 0.900 E1_KOG3316
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001816
OrthoInspector 1 1.000 T616535
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12817
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2318
TreeFam 1 0.960
98.830

Return to query results.
Submit another query.