DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trs33 and trappc6b

Sequence 1:NP_650450.1 Gene:Trs33 FlyBaseID:FBgn0266722 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001006029.1 Gene:trappc6b ZFINID:ZDB-GENE-041010-122 Length:157 Species:Danio rerio

Alignment Length:156 Identity:86/157 (55%)
Similarity:113/157 (72%) Gaps:5/157 (3%)


  Fly     1 MSEEILFDCLHAEIVNYCL-----DSNKEHDLATLEYIGFTTGYRLIERLTREVSRFKDELETMK 60
            |::|.||..||:||:.|..     :|.....::.||.:||..|..||||.|::..||||||:.||
Zfish     1 MADEALFQFLHSEIIQYVNSAETGESENGRCVSKLENMGFRVGQGLIERFTQDTPRFKDELDVMK 65

  Fly    61 FICTDFWMLIYKKQVDNLRTNNHGMYVVQDKAFRFLTRISPGTKQLEHAPKFVAFTCGLVRGALS 125
            |||.|||..::|||:||||||:.|:||:||..||.||::|.|.:.|||||||:||||||||||||
Zfish    66 FICKDFWTSVFKKQIDNLRTNHQGIYVLQDNKFRLLTQLSAGKQYLEHAPKFLAFTCGLVRGALS 130

  Fly   126 NLGINSTVTAEVQSIPACKFHIEVNR 151
            |:|:.|.|||||..:|||||.:.:.:
Zfish   131 NIGVKSIVTAEVSVMPACKFQVMIQK 156

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trs33NP_650450.1 TRAPPC6A_Trs33 4..150 CDD:271347 85/151 (56%)
trappc6bNP_001006029.1 TRAPPC6A_Trs33 3..155 CDD:271347 85/152 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C270202421
eggNOG 1 0.900 E1_KOG3316
Hieranoid 1 1.000
Homologene 1 1.000 H42466
Inparanoid 1 1.050 181 1.000 Inparanoid score I3910
OMA 1 1.010
OrthoDB 1 1.010 D1566836at2759
OrthoFinder 1 1.000 FOG0001816
OrthoInspector 1 1.000 T597406
orthoMCL 1 0.900 OOG5_129131
Panther 1 1.100 LDO PTHR12817
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2318
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.