DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trs33 and trappc6a

Sequence 1:NP_650450.1 Gene:Trs33 FlyBaseID:FBgn0266722 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001001218.1 Gene:trappc6a XenbaseID:XB-GENE-971163 Length:158 Species:Xenopus tropicalis

Alignment Length:157 Identity:79/158 (50%)
Similarity:113/158 (72%) Gaps:6/158 (4%)


  Fly     1 MSEEILFDCLHAEIVNYCL----DSNKEHDLAT--LEYIGFTTGYRLIERLTREVSRFKDELETM 59
            |::|.||:.||.|:|::..    :..::|...|  ||.:||..|..||||||::...|||:||.:
 Frog     1 MADETLFELLHMEMVSHVYEHVEEDEEDHGKHTRVLEGMGFRVGQGLIERLTKDSPSFKDDLEVV 65

  Fly    60 KFICTDFWMLIYKKQVDNLRTNNHGMYVVQDKAFRFLTRISPGTKQLEHAPKFVAFTCGLVRGAL 124
            ||:|.|||.:::|||:||||||:.|.||:||..|..||::|...:.||.||||:.:||||::|||
 Frog    66 KFVCKDFWTILFKKQIDNLRTNHQGTYVLQDNRFMLLTQLSSSKQYLEEAPKFLPYTCGLIKGAL 130

  Fly   125 SNLGINSTVTAEVQSIPACKFHIEVNR 151
            |||||:.||:|||..:|||||.:.::|
 Frog   131 SNLGISCTVSAEVVVMPACKFQVVISR 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trs33NP_650450.1 TRAPPC6A_Trs33 4..150 CDD:271347 77/152 (51%)
trappc6aNP_001001218.1 TRAPPC6A_Trs33 3..156 CDD:271347 77/153 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C270201411
eggNOG 1 0.900 E1_KOG3316
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1566836at2759
OrthoFinder 1 1.000 FOG0001816
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2318
TreeFam 1 0.960
76.740

Return to query results.
Submit another query.